style




FC2CHRVCESDABWSSNIHZGDBBANROYDHMNFSDSSSPRDADNHDKAWAAANATRNACXAUKSMVSDAUKGSANKSBJ

2019-09-05
120 min

[PRED-184]Big Bootied Bookworm Gets Banged Cowgirl Style Aoi Kururugi

  • aoi kururugi censoredcreampieslutPREDpremiumsapporo taroelegancePRED-184PRED184pred00184
    • 2019-09-05
    118 min

    [SSNI-559]The New Female Teacher Gets Violated - Her Students Have Their Way With Her Right In Front Of Her Boyfriend - Miru Sakamichi

  • see the slope censoredsquirtingsingle workSSNIs1 no 1 styleamazing meatSSNI-559SSNI559ssni00559
    • 2019-09-05
    157 min

    [SSNI-560]Total Domain Tall Girl Flashes Her Sexy Legs - A Nympho In Knee Highs Hotaru Nogi

  • nogi firefly censoredschoolgirlsingle workSSNIs1 no 1 stylegoemonSSNI-560SSNI560ssni00560
    • 2019-09-05
    151 min

    [SSNI-564]Enjoy This Natural Airhead's Big Perky Tits To The Max In This Titty Fetish Porno - Mao Mashiro

  • pure white censoredbig titssingle workSSNIs1 no 1 styleusa pyonSSNI-564SSNI564ssni00564
    • 2019-09-05
    181 min

    [SSNI-565]6 First Experiences! Super Ecstatic First Orgasms! 3 Sensually Developing Fucks 180 Minutes Riko Shiraha

  • riko shirahaba censoredbeautiful girlsingle workSSNIs1 no 1 stylekyoseiSSNI-565SSNI565ssni00565
    • 2019-09-05
    130 min

    [SSNI-558]I Fucked A Couple Of Sisters With Big Tits For Three Days Straight While Their Parents Were Out Of Town

  • evening beauty miharu hanasaki censoredbig titsuniformSSNIs one number one styleasagiris1 no 1 styleSSNI-558SSNI558ssni00558
    • 2019-09-05
    167 min

    [SSNI-561]My Short And Delicate Girlfriend Loves Getting Fucked By My Big And Strong Senpai Rika Aimi

  • rumi tadami censoredbig titssingle workSSNIs1 no 1 styleamazing meatSSNI-561SSNI561ssni00561
    • 2019-09-04
    61 min

    [HEYZO-2071]Kanna Kitayama Drilling A Nymphomaniac Busty OL In Office

  • kanna kitayama uncensoredcreampieblowjobheyzo
    • 2019-09-01
    59 min

    [HEYZO-2070]Hitomi Yoshimura Sex With A Hard Working Amateur Woman

  • amateur uncensoredcreampieblowjobheyzo
    • 2019-08-31
    61 min

    [HEYZO-2069]Hitomi Bitch-jo -MILF"s Naughty Seduction-

  • hitomi uncensoredcreampiehandjobheyzo
    • 2019-08-29
    53 min

    FC2PPV 1151964 ☆ First shot ☆ Complete appearance ♡ 160cm 45kg style outstanding! Beautiful busty beautiful skin model class beauty ♪ 20-year-old F cup JD Fuyuka and love love SEX Oma ○ Massive launch in this back! [With benefits]

  • amateur uncensoredfc2
    • 2019-08-27
    140 min

    [KNAM-002]Totally Raw Style @Yua #Pay-For-Play #Nampa Seduction In Harajuku #My First Raw Fuck #I Love To Fuck Raw #Ultra Deep Creampie Sex #F-Cup Titties #A Goddess For Dirty Old Men Yua Takanashi

  • yuu takanashi censoredcreampiebig titsKNAMfirst starcomplete raw styleKNAM-002KNAM002h-491knam00002
    • 2019-08-27
    61 min

    [HEYZO-2066]Reika Seto Beautiful Girl’s After School Life No.33 -Rustic Girl Is Dominated-

  • reika seto uncensoredcreampieblowjobheyzo
    • 2019-08-27
    132 min

    [KNAM-001]Totally Raw Style @Mizuna #Pay-For-Play #The Blowjob Club #Slender With Beautiful Tits #No Raw Fucking Allowed, At All #Her First Creampie Raw Footage #A Girl Who Can Never Refuse Raw Sex #Raw Gang Bang Sex Mizuna Isehara

  • mizuna isehara censoredcreampiebeautiful girlKNAMfirst starcomplete raw styleKNAM-001KNAM001h-491knam00001
    • 2019-08-25
    104 min

    [NSPS-827]A Husband's Extreme Cuckold Daydream - He Makes His Subordinate At Work Fuck His Wife - Maya Takeuchi

  • takeuchi maya censoredmature womansingle workNSPSnagae stylenagaeNSPS-827NSPS827nsps00827
    • 2019-08-25
    126 min

    [NSPS-828]In Order To See If My Beloved Wife Could Be Cuckold Fucked, I Had Her Pose As A Nude Model Nao Yuki

  • naoki yuuki censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-828NSPS828nsps00828
    • 2019-08-25
    122 min

    [NSPS-829]Forbidden! Hot Mamas 5 - A Kind Stepmom Gently Helps Her Stepson Lose His Virginity - Ayano Fuji

  • ayano kato censoredmature womansingle workNSPSnagae stylejotaro tomiNSPS-829NSPS829nsps00829
    • 2019-08-25
    65 min

    [HEYZO-2065]Kyoko Takagi Ex-punk Woman"s Unforgettable Sex!

  • kyoko takagi uncensoredcreampiehandjobheyzo
    • 2019-08-25
    95 min

    [NSPS-830]The Masturbator - I Can't Live Without My Dildo

  • sumire seto sayuki mogami censoredmature womandramaNSPSnagae styleb saku sanoNSPS-830NSPS830nsps00830
    • 2019-08-24
    153 min

    [JUY-955]The Married Woman In The Other Room - Tsubasa Yano

  • yano tsubasa censoredbig titsmature womanJUYmadonnajo styleJUY-955JUY955juy00955
    • 2019-08-24
    61 min

    [HEYZO-2064]Meirin Facial Cum Fiesta! Vol.4

  • meirin uncensoredcreampieblowjobheyzo
    • 2019-08-24
    147 min

    [CJOD-200]I'll Give You A Cleanup Blowjob Until You Squirt Your Load Akari Mitani

  • mitani akari censoredblowjobslutCJODchijo heavencontour styleCJOD-200CJOD200cjod00200
    • 2019-08-22
    59 min

    [HEYZO-2062]Rieko Kohashi A Married Woman Loves To Swallow Cum Vol.2

  • rieko kohashi uncensoredcumshotheyzo
    • 2019-08-20
    61 min

    [HEYZO-2061]Yusa Minami The Body OF A Curvy Cute Petite Girl

  • yusa minami uncensoredcreampieblowjobheyzo
    • 2019-08-18
    60 min

    [HEYZO-2060]Natsumi Owada Nonstop Sexual Orgasm

  • natsumi owada uncensoredcreampieheyzo
    • 2019-08-17
    65 min

    [HEYZO-2059]Rino Sakuragi Cheating With My GF"s Sister

  • rino sakuragi uncensoredcreampieheyzo
    • 2019-08-16
    150 min

    [SSNI-553]Pleasure! First Experiences 6 We're Letting You Luxuriate With A Celebrity In 3 Shameful Extremely Orgasmic Fucks 150 Minutes An Orgasm-Filled Special Marin Hinata

  • marin hinata censoredbig titssquirtingSSNIs1 no 1 stylemon cSSNI-553SSNI553ssni00553
    • 2019-08-16
    121 min

    [SSNI-547]"Dear... Please Forgive Me" Every Time You Were Taking A Bath, For Those 15 Minutes, I Was Always Getting Fucked By your Father-In-Law Nene Yoshitaka

  • nine yoshitaka censoredsingle workdramaSSNIs1 no 1 stylekotobukiSSNI-547SSNI547ssni00547
    • 2019-08-16
    479 min

    [OFJE-210]Miru Sakamichi's First Best Collection - Marking One Year Since Her S1 Debut - 10 Titles, 8 Hour Special

  • see the slope censoredsquirtingbeautiful girlOFJEs1 no 1 styleOFJE-210OFJE210ofje00210
    • 2019-08-16
    119 min

    [SSNI-543]My Teacher Saved Me From Being Bullied, But When She Was Getting Fucked By Some Bad Boys, I Watched Her And Jacked Off. The Thrill Of Watching Someone You Love Being Shamed And Humiliated! A New Kind Of NTR!! Nami Hoshino

  • nami hoshino censoredbig titsSSNIs one number one stylezach arais1 no 1 styleSSNI-543SSNI543ssni00543
    • 2019-08-16
    162 min

    [SSNI-550]This Tsundere Little Sister-In-Law Is Prancing Around Without A Care In The World, Flashing Panty Shot Temptation Every Day Mako Iga

  • iga mako censoredschoolgirlsisterSSNIs1 no 1 stylekyoseiSSNI-550SSNI550ssni00550
    • 2019-08-16
    119 min

    [SSNI-548]But I Was In Love With Her First... I Never Told My Classmate How I Feel, Now I Have To Watch Her Fucking Someone Else... Yura Kano

  • yura kanno censoredbeautiful girlsingle workSSNIs1 no 1 stylebungo maedaSSNI-548SSNI548ssni00548
    • 2019-08-16
    117 min

    [SSNI-544]Undercover Female Cop Infiltrates A Circle Of Gang Bang Molesters Tsukasa Aoi

  • tsukasa aoi censoreddeepthroatsingle workSSNIs1 no 1 stylekitorune kawaguchiSSNI-544SSNI544ssni00544
    • 2019-08-16
    120 min

    [SSNI-549]Her Pussy Was Twitching And Trembling After Orgasming, And Now She Was Getting A Second Helping Of Furious Piston-Pounding Follow-Up Sex Ichika Hoshimiya

  • ichika hoshimiya censoredsingle workSSNIs1 no 1 styleichigoharaSSNI-549SSNI549ssni00549
    • 2019-08-16
    119 min

    [SSNI-546]She Was One Grade Above Him, And He Always Admired This Madonna From Afar, But Now, On This Club Field Trip, They Were Sharing The Same Room, For The 3 Days Straight. Arina Hashimoto

  • there is hashimoto censoredschoolgirlbeautiful girlSSNIs1 no 1 stylejo styleSSNI-546SSNI546ssni00546
    • 2019-08-16
    149 min

    [SSNI-554]Fresh Face No. 1 Body Shihori Kotoi's AV Debut

  • shiori kotoi censoredsingle workSSNIs1 no 1 stylemon cSSNI-554SSNI554ssni00554
    • 2019-08-16
    118 min

    [SSNI-552]Her First Experience! A Gravure Idol With A Godly Ass Tries Some Athletic Sex Techniques Designed To Hit Her G-Spot And Make Her Cum! - Mahoro Kamiki

  • mahoro kamiki censoredsingle workSSNIs1 no 1 styleichigoharaSSNI-552SSNI552ssni00552
    • 2019-08-16
    150 min

    [SSNI-551]110 Furious Orgasms! 4500 Spasms! 1900cc Of Cum Squirts! J-Cup Divine Titties The First Eros Company Awakening Massive Orgasmic Special Jun Kakaei

  • jun jun censoredbig titssquirtingSSNIs1 no 1 stylemon cSSNI-551SSNI551ssni00551
    • 2019-08-16
    119 min

    [SSNI-545]My Stepfather And My Father-In-Law - A Lifetime Of Being Violated By My Two Father Figures... Aika Yumeno

  • yumeno aika censoredbig titssingle workSSNIs1 no 1 stylebungo maedaSSNI-545SSNI545ssni00545
    • 2019-08-16
    152 min

    [SSNI-542]Class Reunion Cuckolding - My Beloved Wife And Her Asshole Ex-Boyfriend Reignite Their Old Flame - Yua Mikami

  • yua mikami censoredbig titssingle workSSNIs1 no 1 styleamazing meatSSNI-542SSNI542ssni00542
    • 2019-08-15
    63 min

    [HEYZO-2057]Sayoko Machimura Toying With A Well-shaped Buxom MILF

  • amateur uncensoredcreampieblowjobheyzo
    • 2019-08-13
    60 min

    [HEYZO-2056]Nana Natsume Naughty High Class Hostess -Sleeping Around For Business Is In Her Line-

  • nana natsume uncensoredcreampieblowjobheyzo
    • 2019-08-13
    104 min

    FC2PPV 1141842 ☆ Outstanding style ☆ Slender D cup beautiful breasts beauty cum shot 2 works bargain set ♪

  • amateur uncensoredfc2
    • 2019-08-11
    259 min

    [NSPS-824]Chosen By Director Nagae, Masterpiece - Father-in-law And Daughter-in-law -Can't Tell Anyone About Our Sexual Relationship-

  • yuriko shiomi makoto ito censoredmature womandramaNSPSnagae stylenagaeNSPS-824NSPS824nsps00824
    • 2019-08-11
    273 min

    [NSPS-826]Lust No Holds Barred! Filthy Kissing Full Collection

  • yuka honjo mika ichijo censoredmature womandramaNSPSnagae styleb saku sanoNSPS-826NSPS826nsps00826
    • 2019-08-11
    274 min

    [NSPS-825]あなたの嫌うあの人と・・ベスト ～愛する夫のために私は大嫌いなアイツにこの肉体を捧げる～

  • makoto ito yuki seijyo censoredNSPSnagae stylekanada haradaNSPS-825NSPS825nsps00825
    • 2019-08-11
    64 min

    [HEYZO-2055]Sumire Kamogawa Amateur Girl"s Sexual Service In School Uniform

  • amateur uncensoredcreampieblowjobheyzo
    • 2019-08-10
    61 min

    FC2PPV 1139645 [Experience type erotic video ☆ complete amateur] Announcer style of local station ♪ New video ≪ №23≫ to take off to a lascivious world from a neat girl and a real date

  • amateur uncensoredfc2
    • 2019-08-10
    115 min

    [HSM-007]Princess Dot Love Ai Sato Her Shocking Adult Video Debut

  • censoredamateurmature womanHSMhime styleHSM-007HSM00759hsm00007
    • 2019-08-10
    60 min

    [HEYZO-2054]Mitsuha Kikukawa My Father Steals My Beautiful Fiance

  • amateur uncensoredcreampieblowjobheyzo
    • 2019-08-09
    54 min

    FC2PPV 1139692 [4K shooting] ☆ Outstanding style ☆ Slender D cup beautiful breasts beauty appears again ♥ ** Nori Nori in play ♪ Creampie with rich SEX! [With benefits]

  • amateur uncensoredfc2
    • 2019-08-09
    80 min

    259LUXU-1154 Luxury TV 1140 A beautiful wife whose sensual beauty style gives off overwhelming sex appeal and individuality is back! Show off the body of a woman who is not cloudy and shine with oil to the big city, and climax many times while shakin

  • amateur censoredbig titsmarried womanluxuluxu-1154luxu1154259luxu-1154
    • 2019-08-08
    153 min

    [DANDY-677]"The Big-Assed Married Woman Couldn't Refuse Doggy Style Cunnilingus And Creampie" vol. 1

  • censoredcreampieDANDYdandybacon tanakaDANDY-677DANDY6771dandy00677
    • 2019-08-04
    63 min

    [HEYZO-2050]Hiroko Nagano Get Slut Creampie!

  • hiroko nagano uncensoredcreampieheyzo
    • 2019-08-03
    121 min

    [SSNI-531]Honeymoon NTR She Was On A Beach With Her Husband, Making Loving Memories, When This Horny Bastard Who Nampa Seduced Her Years Ago Came And Cuckold Fucked This Big Tits Married Woman Saki Okuda

  • saki okuda censoredbig titssingle workSSNIs1 no 1 stylerokusaburo mishimaSSNI-531SSNI531ssni00531
    • 2019-08-03
    63 min

    [HEYZO-2049]Akari Satsuki Sex Spree With Hot Body Girl

  • akari satsuki uncensoredcreampieblowjobheyzo
    • 2019-08-03
    120 min

    [SSNI-530]Sexual Awakening By Hypnotism - Proof That My Girlfriend Was Only Pretending To Have Uncontrollable Orgasms Until Now Minami Kojima

  • minami kojima censoredsquirtingsingle workSSNIs1 no 1 styleichigoharaSSNI-530SSNI530ssni00530
    • 2019-08-03
    120 min

    [SSNI-540]Mao Mashiro Has 3 Powerful Sex Scenes That Make Her Natural H-Cup Tits Bounce And Shake

  • pure white censoredbig titssingle workSSNIs1 no 1 stylemon cSSNI-540SSNI540ssni00540
    • 2019-08-03
    119 min

    [SSNI-537]108 Furious Orgasms! 4,800 Spasms! 12,000 Demonic Piston-Pounding Thrusts! A Minimal Body With Big Tits An Eros Company Awakening In A Massive Spasmic Special Rika Aimi

  • rumi tadami censoredbig titssquirtingSSNIs1 no 1 styleusa pyonSSNI-537SSNI537ssni00537
    • 2019-08-03
    479 min

    [OFJE-208]Tsukasa Aoi 4th Anniversary Special - 77 Scenes From 14 Titles - 8 Hours

  • tsukasa aoi censoredsingle workOFJEs1 no 1 styleOFJE-208OFJE208ofje00208



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download