sister




FC2SSISJULSANAUKGCJODEBODGVHCAWDMVSDSTARSNATRSSNIPPPDFSDSSRBDNGODSQTEADNHMNMILK

2020-05-28
241 min

[HEZ-177]Real Fuck In Front Of Friends!! That's What Makes A Woman Most Embarrassed! Fucking In Front Of Her Friends! They Still Do It Though!! 18 Girls

  • censoredamateurHEZhot entertainmentHEZ-177HEZ17759hez00177
    • 2020-05-28
    78 min

    [hoi-104]枚方さん(32)

  • amateur censoredbig titsamateurhoihoi-104hoi104hoi-104
    • 2020-05-28
    78 min

    [obut-019]まゆ(20)

  • amateur censoredcreampiebig titsobutobut-019obut019obut-019
    • 2020-05-28
    62 min

    [HHKL-038]"Hey Big Stepbrother, Are You Avoiding Me？" "I'm Not, You Idiot! You're Just My Type (That Was What My Heart Was Saying)!" My Little Stepsister Came In While I Was Taking A Bath And Offered To Scrub My Back For Me..

  • censoredsisterHHKLhuntervolvo nakanohhh groupHHKL-038HHKL038hhkl00038
    • 2020-05-28
    185 min

    [EQ-519]We're Taking Home A College Girl For Some Serious Sex! We're Pumping Her Raw Until She Cries With Anal Pleasure! #03

  • censoredbig titsEQbullittkuroto masatoimpulseEQ-519EQ519h-100eq00519
    • 2020-05-27
    138 min

    [GONE-003]Hana Haruna Is Taking A Bath In The STRONG ERO BATH, And We Want To Taste That Strong Stuff For A Fucking Good Time

  • haruna hana censoredcreampiebig titsGONEmercurybirdman teppeia fair skinned elder sisterGONE-003GONE003h-1133gone00003
    • 2020-05-27
    137 min

    [GAID-002]A Fairy Tail 3 A Former Gravure model Who Looks Good In A Super Short Miniskirt And Polo Shirt Renka Yamamoto

  • yamamoto renka censoredcreampiesquirtingGAIDfirst starbirdman teppeiaida first starGAID-002GAID002h-491gaid00002
    • 2020-05-24
    135 min

    [BLOR-145]Usually, This Office Lady Is One Cool Customer, But When She Starts Having Sex, She Unleashes Her Lust Like An Excessively Horny Slut. Her Pussy Goes Great With My Cock And She Knows How To Give An Amazing Lovey-Dovey Good Time!

  • censoredblowjobBLORbroccoli mousouzokubroccolibroccoliBLOR-145BLOR145blor00145
    • 2020-05-23
    119 min

    [HND-840]My Girlfriend's Little Sister Loves Me Too Much, So Now We're Secretly Having Babymaking Sex Together Ichika Matsumoto

  • ichika matsumoto censoredcreampiebeautiful girlHNDhon nakausa pyonHND-840HND840hnd00840
    • 2020-05-23
    120 min

    [DASD-678]Kat Lovers Maria Nagai

  • maria nagai censoredslutDASDdassryo poleDASD-678DASD678dasd00678
    • 2020-05-22
    73 min

    259LUXU-1273 Luxury TV 1263 "I Want To Spend A Hot Night On My Boyfriend’S Birthday …" A Sexually Conscious Lewd Beauty Who Has Stepped Into The World Of AV To Devote All Of Herself To Her Boyfriend! Because Sex That Is Too Exciting

  • amateur censoredamateurluxuluxu-1273luxu1273259luxu-1273
    • 2020-05-22
    35 min

    [CLO-045]Masochism Tits Addicted To Titty Sucking Rina Otomi

  • rina oumi censoredbig titsslutCLOchobitchsuper bitchCLO-045CLO045h-1435clo00045
    • 2020-05-22
    41 min

    [BTH-034]Hello. I'm That Slut Whose Name You Saw Written In The Bathroom... Misuzu Kawana

  • misuzu kawana censoredbig titssingle workBTHchobitchsuper bitchBTH-034BTH034h-1435bth00034
    • 2020-05-22
    55 min

    [WFR-011]This Elder Sister Type Was On Her Way Home And Had Lust To Spare, And She Was Dripping Wet And Cum Crazy All The Way To The Core Kurea Hasumi

  • hasumi claire censoredblowjobslutWFRwaap entertainmenttonkatsuwWFR-011WFR0112wfr00011
    • 2020-05-22
    115 min

    [PARATHD-2891]Selected By Our Discerning Viewers! Amateur Elder Sister Types So Hot You're Guaranteed To Be Stroking Your Cock While You Watch Them Fuck Sex/Blowjob/Cunnilingus/Handjob Best Hits Collection 20 2

  • censoredamateurblowjobPARATHDparadise tvPARATHD-2891PARATHD2891parathd02891
    • 2020-05-21
    120 min

    [HBAD-539]Buxom Sister-In-Law Cameltoe--Forbidden Lust With Her Rock-Hard And Pre-Cum Dripping Brother-In-Law And Father-In-Law An Mashiro

  • anne mashiro censoredbig titssingle workHBADhibinonamitaro umababeHBAD-539HBAD5391hbad00539
    • 2020-05-21
    241 min

    [DAYD-038]Adolescent Fiction Stories Of Yesteryear A Masterpiece Collection 14 Titles

  • censoredsisterDAYDadolscence.compuberty fiction day dreamsDAYD-038DAYD038h-839dayd00038
    • 2020-05-21
    79 min

    200GANA-2290 Seriously Nampa, First Shot. 1488 Bring A Sexy Model-Class Beauty Found In Ebisu To The Hotel! A Beautiful Woman Without A Boyfriend And Without A Saffle Is Obscenely Disturbed By Sex After A Long Absence! !!

  • amateur censoredamateurganagana-2290gana2290200gana-2290
    • 2020-05-21
    143 min

    [HBAD-540]My Little Stepsister Wants To Get Some Bukkake Fun While She's Wearing Her Uniform Waka Misono

  • misono waka censoredbig titsuniformHBADhibinorokutanzo no seishibabeHBAD-540HBAD5401hbad00540
    • 2020-05-21
    161 min

    [SW-706]I Went To Visit My Big Tits Girlfriend At Her House, And I Found Out That Her Sisters Had Even Greater Big Tits! I Didn't Know Where To Look, And When Her Sisters Secretly Started To Lure Me To Temptation, I Couldn't Resist, And Ejacu

  • censoredbig titssisterSWswitchcambridgeswitch switchSW-706SW7061sw00706
    • 2020-05-20
    120 min

    [TTYU-007]I Called A Handyman And A Hard-Body Handy Woman Showed Up, So...

  • erica kitagawa aya takashiro censoredbig titsuniformTTYUstar paradisegotchaTTYU-007TTYU007h-254ttyu00007
    • 2020-05-19
    139 min

    [SDDE-623]NTR x JOI I'm A Cherry Boy And I Take My Masturbation Orders From My Cute Girlfriend/Stepsisters/Friend

  • blue abe mikako censoredslutsisterSDDEsod createaida yumenosenzSDDE-623SDDE6231sdde00623
    • 2020-05-19
    226 min

    [STARS-236]Her Name: Hibiki Natsume Her Formal Debut Her First 4 Fucks

  • natsume hibiki censoredbig titssquirtingSTARSsod createeasy matsumotosod starSTARS-236STARS2361stars00236
    • 2020-05-18
    66 min

    259LUXU-1267 Luxury TV 1261 A Beautiful Tutor With A Glamorous Body Is Appearing On AV To Eliminate Frustration. The Sexual Desire Accumulated In The Pool Raises The Sensitivity, And The Destructive Beauty Big Tits That Make A Man Go Crazy Are Distur

  • amateur censoredbig titsamateurluxuluxu-1267luxu1267259luxu-1267
    • 2020-05-18
    123 min

    [AKDL-028](An Investigative Adult Video) If You Tell A Girl That Today Is Cumming Day Today, And You Keep On Teasing Her With Pull Out Sex, What Will She Do？

  • mizuki hayakawa mihina azumihina mihina nagai censoredbig titsAKDLakinoriakinoriaknrAKDL-028AKDL0281akdl00028
    • 2020-05-17
    121 min

    [MKON-029]My Big Sister Let My Classmate Touch Her Thighs, And It's All My Fault Kanae Kawahara

  • kanae kawahara censoredcreampiesisterMKONkaguyahimept mousouzokunortonmikonMKON-029MKON029mkon00029
    • 2020-05-17
    120 min

    [MKON-030]My Little Stepsister And I Lost My Parents And Were Taken In By Our Distant Relatives, And Since Our Uncle Was Offering To Pay For Our Educations, We Could Never Thank Them Enough Yui Nagase

  • yui nagase censoredcreampieuniformMKONkaguyahimept mousouzokunortonmikonMKON-030MKON030mkon00030
    • 2020-05-17
    129 min

    [IKEP-007]My Friend Really Pisses Me Off, So I Took His Precious Little Sister And Put Her Under Brainwashing H*******m For 3 Months And Turned Her Into A Creampie Cum Bucket, And Here's The Video Record To Prove It (Supervised By The Shibuya H**

  • abe mikako censoredcreampieschoolgirlIKEPla porno daydreamersvagmanIKEP-007IKEP007ikep00007
    • 2020-05-16
    161 min

    [ROYD-007]Suddenly Opening Up About Her Troubles - My Sister's Friend Has A Big Tits Complex - Rino Hazuki

  • rino hazuki censoredcreampiebig titsROYDroyalmorikihhh groupROYD-007ROYD007royd00007
    • 2020-05-16
    67 min

    402MNTJ-020 Aya

  • amateur censoredamateurmntjmntj-020mntj020402mntj-020
    • 2020-05-16
    154 min

    [ROYD-009]When I Spent All Night With My Severe And Skinny Big Tits Lady Boss, She Let Me Get An Exclusive Peek At Her True Self, And That Made Me Want Her For Myself. Yu Shinoda

  • shinoda yu censoredbig titssingle workROYDroyalkawajirihhh groupROYD-009ROYD009royd00009
    • 2020-05-16
    236 min

    [HUNTA-774]She Was Wearing A Tight One Piece Dress That Totally Showed Off Her Panty Lines, And I Immediately Got Rock Hard!! My Neighbors Are All Wearing Thin And Tight One Piece Dresses That Show Off Their Asses And Curves, So...

  • censoredcreampieblowjobHUNTAhunterkoichi davidsonhhh groupHUNTA-774HUNTA774hunta00774
    • 2020-05-16
    208 min

    [HUNTA-775]My Little Stepsister Was Still Underdeveloped, But After I Creampie Fucked Her, She Belonged To Me! She's So Naive And Innocent And Still Growing! Once We Started Living Together In My Cramped One-Room Apartment...!？

  • censoredcreampiesisterHUNTAhuntercognac kaminohhh groupHUNTA-775HUNTA775hunta00775
    • 2020-05-16
    115 min

    [ROYD-006]Usually My Little Stepsister Is A Cute Plain Jane With A Big Ass, But Then She Started Showing Off The Total Domain Of Her Pussy, And By The Time I Realized What Was Happening, I Had Creampie Fucked her. Akari Neo

  • akari neo censoredcreampiebeautiful girlROYDroyalcognac kaminohhh groupROYD-006ROYD006royd00006
    • 2020-05-16
    69 min

    [ETQR-134]My Excessively Emotionally Disturbed Little Stepsister Is Cumming At Me With Sexual Desires! Nozomi Arimura

  • arimura nozomi censoredcreampieuniformETQRerotic timeETQR-134ETQR134h-1186etqr00134
    • 2020-05-16
    122 min

    [ABPN-009]Tokyo Shared Room Ecstasy This Beautiful Secretary Was Deceived And Fucked By Her Evil Boss

  • censoredcreampieamateurABPNabc mousouzokuwarm and toasty abc daydream crewABPN-009ABPN009abpn00009
    • 2020-05-15
    33 min

    [BTH-031]Dirty Talk in Tokyo - Ayane Suzukawa

  • suzukawa ayane censoredbig titssingle workBTHchobitchsuper bitchBTH-031BTH031h-1435bth00031
    • 2020-05-15
    121 min

    [BANK-001]My C***dhood Friend Has Super Beautiful Big Tits And A Naughty Body And She'll Fuck Anyone, Anytime, Anywhere, Because She's An Incredibly Horny Bitch! Mayu Suzuki

  • suzuki mayu censoredcreampiebig titsBANKpussy banktake chanBANK-001BANK001h-1495bank00001
    • 2020-05-15
    77 min

    259LUXU-1278 Luxury TV 1260 Number Of Experienced People Two People! ？？ An Innocent School Teacher Makes An AV Appearance In Search Of Stimulation! A Beautiful Busty Female Teacher With A Slender Body Straddles Ji ● Po And Is Disturbed In A Fierce An

  • amateur censoredbig titsamateurluxuluxu-1278luxu1278259luxu-1278
    • 2020-05-15
    108 min

    [VRTM-498]This Little Stepbrother Couldn't Take The Strain Of Being Celibate While Being Hospitalized, So When He Gave His Big Ass Big Stepsister (A Nurse) Some Aphrodisiacs, She Started Flashing Panty Shot Action And Rubbing Her Dripping Wet Cun

  • moe minami sakuraba hikari censoredcreampiesisterVRTMv r producegoro koenjiVRTM-498VRTM498h-910vrtm00498
    • 2020-05-15
    244 min

    [DOCP-224]Front Closure Bra Temptation 4 I Was Peeping On The Big Tits Beauty Who Lived Across From me, And I Could Tell That She Was Bashfully Removing Her Bra, And Starting To Lure Me To Temptation... I Lost My Mind, And Allowed Her To Tempt Me As

  • sea sky flower chinatsu hashimoto censoredbig titsDOCPprestigedoc premiumDOCP-224DOCP224118docp00224
    • 2020-05-15
    209 min

    [PYM-338]Self Shots Overflowing Juicy Masturbation

  • censoredsquirtingPYMprimoPYM-338PYM338h-283pym00338
    • 2020-05-15
    189 min

    [BAZX-234]Career Receptionist Dirty-Girl's Carnal Welcome vol. 001

  • censoredcreampieuniformBAZXbazookatodoBAZX-234BAZX234h-1496bazx00234
    • 2020-05-15
    115 min

    [PARATHD-2885]I Was At A Hot Spring Resort And I Ordered A Female Massage Therapist And When This Half-Asian Lady Came Over, She Seemed Incredibly Fuckable

  • censoreduniformamateurPARATHDparadise tvPARATHD-2885PARATHD2885parathd02885
    • 2020-05-15
    120 min

    [MDTM-634]The Story Of Ovulation Day Babymaking Sex With A Cum-Crazy Prematurely Ejaculating Sensual Little Stepsister Nozomi Arimura ACT.007 007

  • arimura nozomi censoredcreampieuniformMDTMuchu kikakutodoMDTM-634MDTM634h-585mdtm00634
    • 2020-05-14
    65 min

    413INST-028 Cousin Married Woman Duo GET ★ Miraculous Sister Donburi! !! All the guys I meet are erotic married women who eat cock ♪ I want to have sex with my savvy OL older sisters and I’m squid and seeded Boys Gonzo!

  • amateur censoredcreampiebig titsinstinst-028inst028413inst-028
    • 2020-05-14
    167 min

    [IBW-779]While Our Step Parents Were Away, My Little Stepsister And I Fucked All Day. Mitsuki Nagisa

  • mitsuki nagisa censoredsisterIBWi b worksIBW-779IBW779
    • 2020-05-13
    65 min

    259LUXU-1270 Luxury TV 1259 A Glamorous Beauty With An Exotic Atmosphere And A Unique Pheromone! A Body That Shines Bewitchingly Oiled, Big Tits And A Big Butt Dance Unpleasantly Every Time A Piston Is Made, And Panting With An Ecstatic Expression!

  • amateur censoredbig titsamateurluxuluxu-1270luxu1270259luxu-1270
    • 2020-05-12
    125 min

    [KTRA-216]Little Demon J. Tempted By My Younger Sister-in-law: Yukiho Shirase

  • yukiho shirase censoredcreampiebig titsKTRAk tribeKTRA-216KTRA216h-094ktra00216
    • 2020-05-12
    58 min

    [SYBI-009]The Ripe And Ready Girl Fucking Right After Getting Up In The Morning Is The Best Way To Fuck Chisa Katase

  • chisa katase censoredbig titssingle workSYBIsod createher resting face is the most beautifulSYBI-009SYBI0091sybi00009
    • 2020-05-12
    239 min

    [GONE-002]An Erotic And Tanned Elder Sister Type A Filthy Sex Entertainment Show Horny Dance Sex! Moe Hazuki

  • moe hazuki censoredsquirtingcosplayGONEmercuryan erotic tanned elder sister in the danGONE-002GONE002h-1133gone00002
    • 2020-05-11
    66 min

    259LUXU-1261 Luxury TV 1258 Experienced People Cannot Be Measured! ？？ A Sexually Unrestrained Hedonist Appears In AV! Feratech That Fascinated Countless Men! Sex Is My Instinct, With An Ecstatic Expression On My Face.

  • amateur censoredamateurluxuluxu-1261luxu1261259luxu-1261
    • 2020-05-11
    67 min

    IDJS-010 Shouko

  • amateur censoredamateuridjsidjs-010idjs010idjs-010
    • 2020-05-10
    151 min

    [CHRV-108]My Little Stepsister Is So Horny And Has Such Colossal Tits That Are Worth More Than Just One Look, You've Gotta Take A Second Look! Hey, Is It Okay For You To Cum Inside Me> H-Cup 97cm Tits Hikaru This Perverted Big Stepbrother And S

  • censoredcreampiebig titsCHRVcherry revolution daydream tribecherry s reboCHRV-108CHRV108chrv00108
    • 2020-05-10
    151 min

    [CHRV-109]This Little Stepsister Has Big Tits That Are Worth More Than Just One Look, And She Simply Loves Her Big Stepbrother's Erect Nipples! H-Cup 103cm Tits Maho Is A Big Titty Girl! Her Big Stepbrother Is Crazy For Nipples! He's Going To

  • censoredcreampiebig titsCHRVcherry revolution daydream tribecherry s reboCHRV-109CHRV109chrv00109
    • 2020-05-10
    41 min

    FC2PPV 1365823 A Cute Real Friend Of Natural’Boke’s Has A Half-Sister On A Certain Site And Calls Out Quickly! !!

  • amateur uncensoredfc2
    • 2020-05-09
    120 min

    [IPX-485]A Big Tits Wife Who Got Fucked By Her Personal Trainer 9 NTR Cum Shots, With No Time Limits!! Momo Sakura

  • sakura sky momo censoredbig titsblowjobIPXidea pocketdragon nishikawatissueIPX-485IPX485ipx00485
    • 2020-05-09
    160 min

    [IPX-493]Days Of Passionate, Orgasmic Sex, With My Lover's Lady Boss, Until My Balls Went Dry. Saeko Matsushita

  • saeko matsushita censoredcreampieblowjobIPXidea pocketkyouseitissueIPX-493IPX493ipx00493
    • 2020-05-09
    120 min

    [MIAA-272]When I Watched My Little Stepsister Get Fucked By My Mom's New Husband, All I Could Do Was Get A Sad Erection. Ichika Matsumoto

  • ichika matsumoto censoredcreampiesisterMIAAmoody shiroharu osakieveryone s kikatanMIAA-272MIAA272miaa00272
    • 2020-05-09
    120 min

    [IPX-490]"Will This Be Enough For You To Sign On The Dotted Line？" The Lady At The Housing Company Is SK**lfully Tempting Me To Temptation With Her Excessively Exposed Lusty Lingerie This Lady Knows How To Get Shit Done!! Tsubasa Amami

  • amami tsubasa censoredcreampieslutIPXidea pocketzach araitissueIPX-490IPX490ipx00490



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download