daughter




FC2AVSACJODABWVENXJULGMEMROYDBBANNNPJDTTAPODGVHCHRVSHKDNATRWAAACESDMEYDADNAUKG

2012-05-30
21 min

[053012-035]If My GF were Nozomi Hazuki

  • nozomi hazuki uncensoredcreampiecaribbeancom
    • 2012-07-05
    102 min

    [SHKD-475]Fucked In Front Of Her Husband: Aoi Mikuriya Is Abused by Her Sleazy Former Supervisor

  • aoi mitake censoredsingle workSHKDattackersnagira kenzosharkSHKD-475SHKD475shkd00475
    • 2012-08-10
    50 min

    [081012_403]先生の教育方針は、足コキです

  • amateur uncensored1pondo
    • 2013-03-15
    57 min

    [high-175]みなみ(20)

  • amateur censoredamateurbeautiful girlhighhigh-175high175high-175
    • 2013-04-26
    61 min

    [042613-321]I Love you Senpai!

  • tsuna kimura uncensoredcreampiecaribbeancom
    • 2014-01-09
    118 min

    [MIAD-661]H Cup Curvy and Busty Fresh Face Soapland Girl Nami Itoshino

  • aino nami censoredbig titsMIADmoody sgory matsudamoodyz acidMIAD-661MIAD661miad00661
    • 2014-03-29
    118 min

    [WANZ-176]Beautiful Secret Investigator Kurea Hasumi

  • hasumi claire censoredcreampiebig titsWANZwanz factorywanzWANZ-176WANZ1763wanz00176
    • 2015-02-28
    150 min

    [MIDE-204]Ultra Superb Slathered Body Agonizing Oil FUCK!! Shiori Kamisaki

  • shiori kamisaki censoredbig titssquirtingMIDEmoodyzcobamoodyz divaMIDE-204MIDE204mide00204
    • 2015-03-10
    113 min

    [n1028]First Time of Gangbang

  • amateur uncensoredanalcreampietokyo hot
    • 2015-09-10
    142 min

    [SW-354]The Bus To My Workplace Is Always Filled With Office Ladies With Sexy Pantyhose Legs! I Couldn't Help But Press My Boner Against Someone...Then I Could Feel Somebody Grabbing It! 4

  • censoredbig titsuniformSWswitchtakeshi yamashiroswitch switchSW-354SW3541sw00354
    • 2015-11-12
    199 min

    [SDNM-064]SOD Married Woman Label The All Time Best Thirty Something Enjoy The Miracle Of This Neat And Clean Beautiful Married Woman Who Stars In This AV Aki Sasaki, Age 35 Chapter 2 "Even While I Was Doing Housework I Couldn't Get The AV Sh

  • aki sasaki censoredsingle workSDNMsod createietarogenuine married woman the porn experienSDNM-064SDNM0641sdnm00064
    • 2015-11-27
    124 min

    [SABA-165]New- After-School Walk With A Hip Schoolgirl. She Does It For The Money. 01 Shuri

  • censoredcreampieschoolgirlSABAs kyuu shiroutotodoSABA-165SABA165h-244saba00165
    • 2016-03-03
    120 min

    [NKKD-008]Caution: Disgusting Content I Was Having A Great Loving Time With My Girlfriend, Who Was Living With Me On A Short-Term Exchange Student Homestay, But The Other Day My Senpai The DQN Found Out And Forced Me To Bring Her To Him, So That'

  • surrey censoredcreampiebig titsNKKDjet eizouupdatingNKKD-008NKKD008nkkd00008
    • 2016-04-01
    106 min

    [KIL-107]The Record Of Young Wives Who Were Molested And Given Cunnilingus By Sleazy Cleaners In A Public Bath Late At Night

  • censoredKILprestigeupdatingKIL-107KIL107118kil00107
    • 2016-04-16
    118 min

    [PPPD-466]Busty Slavish Nursing - Her Devoted & Rejuvenating Titty Fucking - Mikoto Narimiya

  • mikoto narimiya censoredbig titssingle workPPPDoppaiPPPD-466PPPD466pppd00466
    • 2016-07-30
    206 min

    [ZUKO-107]Bust In! The Mysterious Sex Cult In Suginami

  • nanase otoha aika censoredcreampieZUKOzukkon bakkonrakudaZUKO-107ZUKO107zuko00107
    • 2016-10-18
    56 min

    [HEYZO-1296]Yuu Nakano Creampie Prank -Sneaky No Condom Sex- Vol.5

  • yuu nakano uncensoredcreampieamateurheyzo
    • 2016-10-29
    147 min

    [WANZ-559]Up Close And Personal With A Lusty And Sex Addicted Fitness Instructor Who Gives Voluptuously Ejaculatory Lessons Yuri Nikaido

  • yuri nikaido censoredslutsingle workWANZwanz factorywanzWANZ-559WANZ559wanz00559
    • 2016-11-25
    151 min

    [LOVE-329]I Know You Want A Hot And Horny Girl, Right？ This Hot Surfer Gal Knows What Makes A Man Tick!

  • censoredbeautiful girlslutLOVEfirst starpocky shibataLOVE-329LOVE329h-491love00329
    • 2016-12-18
    133 min

    [EMAZ-344]Overcum By Sex For The First Time At 58 Shiho Kakukura

  • shiho tsunokura censoredcreampiemature womanEMAZfujinsha emmanuelleenbu hiragifujinshaEMAZ-344EMAZ344emaz00344
    • 2017-05-28
    115 min

    [PARATHD-2000]I Want To Fuck The Wife Next Door: She's Always My Wank Material! (9) I Want To Enter That Big Arse From Behind!

  • censoredmarried womanmature womanPARATHDparadise tvPARATHD-2000PARATHD2000parathd02000
    • 2017-06-18
    244 min

    [HUNTA-315]These Ultra Horny Mama Friends Are Getting Such Hard Orgasms They're Spasming Their Brains Out! My Son Is A Lusty Sex Monster... Her Son Was So Horny That She Worried For His Future... Every Day, From Morning Til Night, Whenever He Had

  • censoredHUNTAhuntermorikihhh groupHUNTA-315HUNTA315hunta00315
    • 2017-08-11
    120 min

    [SABA-296]Super Class Amateurs' First Time On Camera A Double AV Debut! Two Completely Opposite Type Mama Friends Are Making Their AV Debuts An Ultra Pervert Mama Azumi A Horny Slut Mama Saki

  • censoredbig titsamateurSABAskyu shirototodoSABA-296SABA296h-244saba00296
    • 2017-09-01
    244 min

    [AVOP-319]A Beautiful Transsexual Natural Airhead Girl. Seri Kizuki. Retire

  • castle star censoredbeautiful girlsingle workAVOPdaspiero daav open 2017AVOP-319AVOP319avop00319
    • 2017-09-10
    300 min

    [CHRV-046]Colossal Tits BOOTLEG K Cup 108cm Lucky Cherry Popping Official Pirated Version No More AV Piracy!

  • censoredcreampiebig titsCHRVcherries rebo delusioncherries reboCHRV-046CHRV046chrv00046
    • 2017-09-18
    153 min

    [CESD-449]The NTR Hot Springs Resort We're Conducting S&M Outdoor Exhibitionist Training With This Married Woman! Misaki Kanon

  • misaki kanon censoredmature womanbdsmCESDceleb no tomosakura fubukiCESD-449CESD449cesd00449
    • 2017-10-10
    106 min

    [SKY-081]Sky Angel Vol.47 : Ririka

  • ririka uncensoredcreampietokyo hot
    • 2017-10-28
    150 min

    [SSNI-036]The Alluring Total Domain Schoolgirl Enjoy Miniskirt, Knee-High Socks, And Flashes Of Bare Legs Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemonSSNI-036SSNI036ssni00036
    • 2018-02-25
    120 min

    [EIKI-066]My Daughter Would Never Do Such A Thing... "Why Do You Keep Filming My Tits..." She Bashfully Protested, As My Beloved Daughter Let The Teacher Defile Her Body [NTR] Creampie Raw Footage With Schoolgirls Tsubasa

  • hinakiku tsubasa censoredcreampieschoolgirlEIKIbig mocalmamezawa mametaroeikiEIKI-066EIKI06657eiki00066
    • 2018-03-09
    121 min

    [030918_003]S Model 181 超絶品ボディ極上美女中出しSEX

  • amateur uncensoredcaribbeancompr
    • 2018-05-25
    171 min

    [MCSR-297]*Bonus With Streaming Editions Only* She Was Getting An Amazing Orgasmic Oil Massage While Her Husband Slept Nearby She Couldn't Scream With Pleasure, So This Big Tits Housewife Had To Endure Creampie Cuckold Sex! 02

  • yoshikawa aimi kirishima sakura censoredmarried womanMCSRbig mocalyumejimuscatMCSR-297MCSR29757mcsr00297
    • 2018-06-15
    160 min

    [DVDMS-273]This Housecleaning Lady Who Was Working At My House Was Wearing These Tight Pants, And When I Could No Longer Resist, I Shoved My Big Dick In From Behind And Had Myself A Quickie! 6 She Protested, "But I Have A Husband..." But I Fo

  • censoredmarried womanamateurDVDMSdeepsluminaxdeep sDVDMS-273DVDMS273dvdms00273
    • 2018-07-09
    56 min

    FC2PPV 876450 [Personal shooting] ☆ First shot! Complete appearance ☆ Plump G cup nympho married woman vaginal cum shot! [With ZIP]

  • amateur uncensoredfc2
    • 2018-07-27
    245 min

    [MGT-038]We're Picking Up Girls And Finding Hot Amateur Babes! Vol.19 - Picking Up Girls And Drinking With Married Woman Babes In The Afternoon -

  • censoredmarried womanamateurMGTprestigemegatraMGT-038MGT038118mgt00038
    • 2018-08-03
    33 min

    FC2PPV 895616 Goddess Second Coming ♥ Female Anna Candidate S Class Shaved Beauty ♥ Active JD Love Juice With The Taste Of A Dick Squirting Sexual Desire Awakening ♥ Forbidden Raw Saddle SEX Lifted Estrus Omanko Skewered Demon Piston ♥ [No Mosaic]

  • amateur uncensoredfc2
    • 2018-08-23
    120 min

    [SDAB-065]Molester in the J School Forced to Orgasm Without Making a Sound Natsu Hashimoto

  • nao hashimoto censoredbeautiful girlsingle workSDABsod createasagiri jouSDAB-065SDAB0651sdab00065
    • 2018-09-11
    104 min

    FC2PPV 926790 [480 yen] [Telephone scene omnibus ② 55 barrage 104 minutes recording] [Married woman plunder NTR complete version] [Personal shooting] With ZIP

  • amateur uncensoredfc2
    • 2018-09-22
    54 min

    [230OREC-105]あずさ

  • amateur censoredcreampiebig titsorecorec-105orec105230orec-105
    • 2018-10-12
    119 min

    [MIAE-316]I'm A Perverted Masochist, I Want You To Strangle Me And Make Me Come. Nanako Miyamura

  • nanako miyamura censoredsquirtingbdsmMIAEmoody scomet akaimoodyz acidMIAE-316MIAE316miae00316
    • 2018-10-26
    273 min

    [SKMJ-010]We're Cheering On Cherry Boy Losers Who Have 0 Chance Of Ever Getting A Girl In Their Homes In This Variety Special! Would You Like To Call A Real-Life College Student Private Tutor To Your Home For An All-Or-Nothing Sex Education And C

  • censoredcreampieamateurSKMJred face girlyuseiSKMJ-010SKMJ010h-1324skmj00010
    • 2019-01-08
    50 min

    [c0930-ki190108]百瀬 梨絵 23歳

  • amateur uncensoredc0930
    • 2019-04-04
    159 min

    [JUY-808]When All Is Said And Done, Amateur Housewife Sex Is The Rawest And Best!! Meet An Apartment Wife In Glasses, Who Lives Primly And Properly In A Public Housing Apartment Complex, But Is Actually A Horny Slut Mimika Toda 30 Years Old Her Adult

  • mika toda censoredmature womansingle workJUYmadonnamametaro mamezawaJUY-808JUY808juy00808
    • 2019-04-28
    117 min

    [BLOR-120]A Voluptuous, Busty Girl Who Works At A Gym. She's Always Smiling And She's The Face Of The Gym. She Gets Fucked With A Big Dick And Orgasms For Real!

  • censoredbig titsBLORbroccoli mousouzokubroccoliBLOR-120BLOR120blor00120
    • 2019-05-15
    20 min

    [051519-920]Pussy Encyclopedia

  • yui nanami uncensoredcaribbeancom
    • 2019-06-06
    135 min

    [SDMU-936]<Super Sensitive> Flat-chested Cosplayer Kafuka Natsume Makes Her Porn Debut With A Little Embarrassment And Much Cumming

  • natsume censoredcosplaySDMUsod createkoenji goroSDMU-936SDMU9361sdmu00936
    • 2019-06-29
    45 min

    FC2PPV 1115165 (There is a mosaic) [Factory beautiful girl] When I hit a new employee with a bitch smell, I was witnessed by the president and I just made 3P ww

  • amateur uncensoredfc2
    • 2019-07-12
    161 min

    [MDBK-041]Competitive Swimsuit Instructor Eating-Up Convulsive Climax

  • manami oura kurosaki mika censoredcreampiesquirtingMDBKmedia stationbazookaMDBK-041MDBK04161mdbk00041
    • 2019-07-26
    167 min

    [KNMD-033]Modern Legendary Tales Of Men And Women Nanako Takamiya

  • nanako takamiya censoredmature womanbdsmKNMDkinemakikujiro akabaneKNMD-033KNMD033h-1352knmd00033
    • 2019-08-09
    119 min

    [MDTM-550]All New The After School Beautiful Girl Rejuvenating Reflexology Salon+ Vol.025 Riona Mana

  • mana rio censoredcreampieblowjobMDTMmedia stationtodouchu kikakuMDTM-550MDTM55061mdtm00550
    • 2019-08-25
    124 min

    [BLOR-128]This Boyish Girlfriend Was Almost Like One Of The Guys, But She Was A Secretly Big Tits Cunt! She Was The Life Of The Party, But Now She Was Forced Into Weeping, Sobbing, Ecstasy!

  • censoredbig titsBLORbroccoli mousouzokubroccolibroccoliBLOR-128BLOR128blor00128
    • 2019-11-09
    240 min

    [HJMO-418]Red Light, Green Light - With A Fixed Vibrator 15

  • censoredsquirtingHJMOhajime kikakuhajimeHJMO-418HJMO418hjmo00418
    • 2019-11-23
    110 min

    390JAC-019 [Beautiful H Big Breasts x Creampie x 5 Barrage] Kamijiri! God milk! God face! Isn’t it a god anymore？ Night dew death! I don’t have rubber, I’m taking pills, I’m not satisfied by myself, I don’t know how many time

  • amateur censoredcreampiebig titsjacjac-019jac019390jac-019
    • 2020-01-12
    150 min

    [APOD-017]This Beautiful Girl Overflowing With Innocence Has Really Only Been With One Person

  • censoredcreampieamateurAPODapollo daydreamersapollo apollo daydreamersAPOD-017APOD017apod00017
    • 2020-02-07
    40 min

    FC2PPV 1268182 [Individual] A Busty Wife With Sober Glasses, Surrounded By Two Strangers’ Sticks, Is Fucked By A Raw Vagina And Vaginal Cum Shot Is Made.

  • amateur uncensoredfc2
    • 2020-02-07
    38 min

    [xxx-av 20677]双葉みか　琥珀うた　セクシー居酒屋　フルハイビジョン　vol.01

  • amateur uncensoredxxx av
    • 2020-04-20
    172 min

    [ANZD-007]Local Men Eat Up Amazing Slut - Tsugumi-chan (22) Close Up Passionate Creampie Fuck With Country Girl

  • censoredcreampieamateurANZDanzu daydream vacationanzuANZD-007ANZD007anzd00007
    • 2020-04-24
    77 min

    FC2PPV 1347025 [Creampie] Very Popular Apparel Clerk Ami-Chan 19 Years Old 2nd! Iku To Conceive With Serious Seeding Raw Sex! !! [Personal Shooting First Shot]

  • amateur uncensoredfc2
    • 2020-05-19
    138 min

    [SDJS-067]SOD Female Staff - 4 Legends Of The Porn Industry Teach How To Fuck And Make Your Partner Feel Good - Koharu Asai

  • asai miku abe censoredlesbianSDJSsod createhitoshi nimurasod female employeeSDJS-067SDJS0671sdjs00067
    • 2020-06-11
    182 min

    [JUFE-183]Boyish Beauty Non-nude Erotica Idol Ami Joins AV!! Thick F-Cup Body Takes Huge Cocks 3 Full Fucks

  • censoredbig titsJUFEaurora project annexusa pyonfitchJUFE-183JUFE183jufe00183
    • 2020-06-12
    239 min

    [CEAD-307]Totally Freshly Filmed! A Voluptuous Elder Sister Type With An Erotic Ass Is Wearing Tight Black Pantyhose While Having Sex

  • maria nagai manami oura censoredcreampiemature womanCEADk m produceceleb no tomoCEAD-307CEAD307cead00307



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download