cowgirl




FC2HODVDASDAWDBLKMIDVAUKSHMNAMBINGODSSISHNDGMEMNACRPPPDSPRDNATRCESDCAWDMVSDSQTE

2023-06-08
119 min

FSDSS-617 She Has An Exceptionally Low Hurdle To SEX Even If You Have A Boyfriend, You Can Insert It Into Anyone"s Dick And Get It With Premature Ejaculation Ikuiku Sexual Intercourse. Natsu Igarashi

  • igarashi natsu censoredsingle workFSDSSfaleno2 consecutive rate 25faleno starFSDSS-617FSDSS6171fsdss00617
    • 2023-06-08
    123 min

    FSDSS-613 Unleash Sexual Desire From Extreme Endurance. 1 Month Abstinence Squirting Screaming Acme 3 Production Mion Sakuragi

  • sakuragi mio censoredblowjobFSDSSfalenoboomer 44faleno starFSDSS-613FSDSS6131fsdss00613
    • 2023-06-08
    157 min

    MIST-402 Dangerous Day Direct Hit! ! Soap That Can Make A Child 46 Hinako Mori

  • hinako mori censoredcreampiecosplayMISTmr michirusaitaMIST-402MIST4021mist00402
    • 2023-06-07
    43 min

    SDMM-13201 [Mina Edition] Magic Mirror No. Health And Physical Education Extracurricular Class Active Girls ○ Show Off The Rich SEX Of Adults In Front Of Students! Ignited My Adolescent Sexual Curiosity And Experienced Cumming At A Stakeout Cowgirl F

  • yuka hirose censoreduniformschoolgirlSDMMsod createsaijo akiramagic mirrorSDMM-13201SDMM132011sdmm13201
    • 2023-06-06
    132 min

    KECB-126 [4K Remastered Version] I"ll Lend You The Key To M-kun"s Apartment. Akari Mitani

  • mitani akari censoredslutsingle workKECBwarp entertainmentthere is alsowaap group ai remasterKECB-126KECB12624kecb00126
    • 2023-06-06
    34 min

    fc2-ppv 3424940 [Uncensored] ``It"s Special ♡"" Excessive Back Handjob Footjob Bullying, &quotVacuum Fellatio" Squeeze The Roots Until The Gold Ball Is Empty And Thick Semen Ejaculation FC2-PPV-3424940

  • amateur uncensoredamateur
    • 2023-06-05
    67 min

    HEYZO-3068 Yoko Hanada [Yoko Hanada] Is It Good Until The End？ Bareback In An AV Interview! Vol.2

  • yoko hanada uncensoredcreampiemarried woman
    • 2023-06-04
    51 min

    fc2-ppv 3422409 [One Shot] First Shot A J School Student Until March An 18-year-old Female College Student Who Has Just Moved To Tokyo.

  • amateur uncensored
    • 2023-06-04
    93 min

    HMDNV-610 [Fluffy Bowl-shaped Boobs] G-cup Slender Slut Wife 27 Years Old. Oil-covered Fuck That Melts Your Brain At A Hotel With A Handsome Friend! NTR Creampie That Squeezes Plenty Of Semen At The Cowgirl Position! !

  • censoredcreampieHMDNVhamedori.network secondeditionHMDNV-610HMDNV610h-1472hmdnv00610
    • 2023-06-03
    240 min

    YMDD-329 Our Hamamao Goes! 240 Minutes Of Non-stop Spouting! Hamasaki Mao Best! !

  • hamazaki mao censoredcreampiesquirtingYMDDmomotaro video publishingdr ishikiri bridgeyoung peachYMDD-329YMDD329ymdd00329
    • 2023-06-03
    61 min

    HEYZO-3067 Yoko Hosokawa [Yoko Hosokawa] Fucking A Frustrated Saffle Who Wants To Fuck Vol.4

  • yoko hosokawa uncensoredcreampiehandjob
    • 2023-06-03
    118 min

    RPIN-073 Plump H-Cup Dentist Receptionist Plump Meat Service Plump Body With A Big Cock!

  • censoredamateurRPINlycopene delusion groupsho soraRPIN-073RPIN073rpin00073
    • 2023-06-02
    61 min

    HEYZO-3066 Rina Kawamura [Rina Kawamura] Nasty Married Woman"s Naughty Afternoon Vol.2

  • rina kawamura uncensoredcreampieslut
    • 2023-06-02
    120 min

    MIAA-842 The Secret Face Of The Class President That Only I Know. I Was Seduced By A Neat And Clean Classmate Who Showed Me Anal Vulgarly And Was Tempted To Cum Inside Me. Lima Arai

  • lima arai censoredanalcreampieMIAAmoody stiger gaveleveryone s kikatanMIAA-842MIAA842miaa00842
    • 2023-06-02
    120 min

    MIAA-859 I Hit It Off With A Late Gal Aunt Who I Often Meet At The Neighborhood Supermarket And Invited Me To Her House. AIKA

  • aika censoredcreampiesingle workMIAAmoody scaptain gangwoneveryone s kikatanMIAA-859MIAA859miaa00859
    • 2023-06-02
    117 min

    CAWD-538 A Happening In A Shared Room With A Beautiful Boss I"m Longing For When I Get Drunk, I Become A Kisser And Lost My Memories Ms. Ito"s Pile Driving Piston Cowgirl Over And Over Again And Again And Again And Again And Again Maiyuki Ito

  • maiyuki ito censoredcreampiesingle workCAWDkawaiiinabarCAWD-538CAWD538cawd00538
    • 2023-06-02
    180 min

    WAAA-269 If You Can Endure Himari Kinoshita"s Amazing Technique, You Can Have Raw ★ Creampie SEX!

  • himari kinoshita himari hanazawa censoredcreampieslutWAAAones factorywanzWAAA-269WAAA269waaa00269
    • 2023-06-02
    120 min

    WAAA-275 "Eh! Didn"t You Put It Out For Naka Now？" Chasing After Premature Ejaculation Without Pulling It Out With An Extended Piston After An Accidental Discharge! ! Miku Misora

  • misora miku censoredcreampieschoolgirlWAAAones factorywanzWAAA-275WAAA275waaa00275
    • 2023-06-02
    183 min

    MIDV-377 G Cup Miraculous Beautiful Girl Bikkun Bikkun Uterus Convulsions Can"t Stop First 4 Fucks! By Moon Clouds

  • yoru tsukumo censoredbeautiful girlsingle workMIDVmoody susapyonmoodyz divaMIDV-377MIDV377midv00377
    • 2023-06-02
    130 min

    WAAA-267 I Can"t Resist My Niece"s No Panties Seduction For Discipline! Little Devil Pee Drinking Slut"s Piss Drinking Cunnilingus Oma ○ Rubbing Sexual Intercourse Anna Hanayagi

  • hanayanagi anna censoredsquirtingslutWAAAones factorywanzWAAA-267WAAA267waaa00267
    • 2023-06-02
    120 min

    MIDV-370 "I"m Already Ejaculating!" Busty Tutor Hinano Kuno Who Comes Many Times Even In The State

  • kuno hinano s censoredbeautiful girlslutMIDVmoody scomet akaimoodyz divaMIDV-370MIDV370midv00370
    • 2023-06-02
    240 min

    BMW-283 Beautiful Breasts X Slender Waist X Amazing Technique SSS Class Beauty Who"s Not Just Pretty Sumire Mizukawa BEST 9 Production 58 Ejaculation

  • mizukawa violet censoredcreampieslutBMWones factorywanzBMW-283BMW283bmw00283
    • 2023-06-02
    160 min

    MIAA-861 To Live In A Shared Room With Two Sisters-in-law Who Were Able To Remarry Their Parents! I"m Forced To Cum Every Day Until The Morning With W Stakeout Cowgirl & W Nipple Torture. Megu Mio Airi Honoka

  • mio meg hobana airi censoredcreampiesisterMIAAmoody skyouseieveryone s kikatanMIAA-861MIAA861miaa00861
    • 2023-06-02
    170 min

    MIDV-308 Sex Appealing Temptation Slut Helper Voluptuous Deca Butt And Plump Thighs Full Erection ○ Po Nursing Care Jinguji Nao

  • jinguji temple nao censoredcreampieslutMIDVmoody strendy yamaguchimoodyz divaMIDV-308MIDV308midv00308
    • 2023-06-02
    238 min

    DVDMS-962 Big Penis Immediately Saddle In The Pita Bread Ass Of Neighborhood Aunt! 7 Forcible Insertion And Stopping Teasing A Beautiful Married Woman Who Remembered The Sexual Desire Of A Female Who Was Forgotten By SEX With A Handsome Piston! "

  • censoredcreampieamateurDVDMSdeepstamao satodeep sDVDMS-962DVDMS962dvdms00962
    • 2023-06-02
    240 min

    BMW-282 30 Consecutive Vaginal Cum Shots To A Woman Who Is Cumming

  • white peach sumire kuramoto censoredcreampieBMWones factorywanzBMW-282BMW282bmw00282
    • 2023-06-01
    20 min

    060123_001 Erotic Cowgirl

  • maria osawa uncensoredblowjobslut
    • 2023-05-30
    140 min

    SDNM-383 Almost No Love Experience! Rena Ibuki, 28 Years Old, A Shy Beautiful Nursery Teacher, Chapter 2, A Married Woman, Taken At The Nursery Teacher"s Weekday Holidays At Her Home! Drowning In Immoral Sex Until The Last Minute Of Her Husband&q

  • ibuki rena censoredsquirtingsingle workSDNMsod createkyouseireal married woman av experience without telling her husbandSDNM-383SDNM3831sdnm00383
    • 2023-05-29
    65 min

    HEYZO-3064 Hinata Sagiri [Hinata Sagiri] Immoral Girl"s Betrayal SEX ~Men Who Swarm Around Their Voluptuous Body

  • hinata sagiri uncensoredcreampie
    • 2023-05-27
    233 min

    FGEN-001 Nasty Slut Who Squeezes Out Sperm Eimi Fukada

  • emi fukada censoredcreampieslutFGENfirst starf generateFGEN-001FGEN001h-491fgen00001
    • 2023-05-27
    84 min

    CSPL-016 [4K] 4K Revolution Dere Cute, But... Can"t Stop. Nakagusuku Aoi

  • nakagusuku censoredcreampieuniformCSPLcrystal picturecosdeluxe plusCSPL-016CSPL016cspl00016
    • 2023-05-27
    60 min

    HEYZO-3059 Hiroko Sunada [Hiroko Sunada] A Married Office Lady Came To Deal With Complaints, So I Had Her Body Respond

  • hiroko sunada uncensoredcreampie
    • 2023-05-26
    125 min

    SKMJ-394 A Cute Girl Among Her Friends ○ Student Gives A Masochistic Man A Great Nipple Torture! ？ A Nipple Trance That Teases A Man"s Erogenous Zone [Chikubi] That Is Not Taught At School So Much That It Melts! Excited About A Boy Who Feels Like

  • censoredcreampieschoolgirlSKMJblush girlasmaxSKMJ-394SKMJ394h-1324skmj00394
    • 2023-05-26
    55 min

    HEYZO-3058 Mirai Minano [Minano Mirai] After 6 ~ I Can"t Stand It And I"m Going To Do It In The Office! ~

  • mirai minano uncensoredcreampiecosplay
    • 2023-05-26
    61 min

    WFR-027 HYPER FETISH Clothed Big Tits Riko Momose

  • momose riko censoredslutsingle workWFRwarp entertainmentpork cutletwWFR-027WFR0272wfr00027
    • 2023-05-26
    134 min

    HODV-21766 [Libido Bug Is A Punch ○ Chin Eating Fishing] Neccho Sex Blows Reason With Divine Breasts Beauty 4 Production Eru Shiina

  • shiina eru censoredcreampiesquirtingHODVh m pbottomsHODV-21766HODV217665642hodv21766
    • 2023-05-26
    136 min

    HODV-21767 When I"m Alone With My Cute Colleague Who Speaks Kitakyushu Dialect, I Have Lovey-dovey Dialect Sex Mizuki Yayoi

  • mizuki yayoi censoredcreampiesingle workHODVh m pk c takedaHODV-21767HODV217675642hodv21767
    • 2023-05-25
    67 min

    fc2-ppv 3373972 *Limited To One Week* [Pleasure Addiction] 25-year-old Newlywed Gal Wife. Gym Trainer"s Muscle Fuck Makes The Cock Fall!! Convulsions With Portio Continuous Hits Acme Hardcore Seeding NTR [Nori Good And Tight!]

  • amateur uncensoredcreampiemarried woman
    • 2023-05-25
    170 min

    DLDSS-187 Suzume Mino, Who Was Handed Only One Condom To An Unequaled Virgin College Student"s House, If She Stayed One Night... Suzume Mino

  • suzume mino censoredcreampiebig titsDLDSSdahliakannana dynanaDLDSS-187DLDSS1871dldss00187
    • 2023-05-25
    223 min

    FSDSS-592 A Dense Hot Spring Trip That Entangles Saliva And Shakes Itself And Drowns In Sex. Natsu Igarashi

  • igarashi natsu censoredblowjobFSDSSfalenokei isoifaleno starFSDSS-592FSDSS5921fsdss00592
    • 2023-05-25
    227 min

    DANDY-859 3 Cm To The Crotch! Miss Menes Vol.1

  • censoredDANDYdandyyamazaki sennenDANDY-859DANDY8591dandy00859
    • 2023-05-25
    70 min

    KAMEF-033 Individual Shooting Specialized Campaign Girl Photo Session Narumi-chan (20) Machida Lens"s BLACK KAMEKO FILE.33 Weekly Magazines Featuring Many Corporate Projects Gravure Squirting Individual Shooting A Natural Nasty Model Who Is Shaki

  • censoredcreampiesquirtingKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-033KAMEF033h-1350kamef00033
    • 2023-05-22
    60 min

    HEYZO-3056 Sakurai Sakura [Sakura Sakura] Amateur Girl Who Is Good At Sucking

  • sakurai sakura uncensoredcreampie
    • 2023-05-20
    51 min

    fc2-ppv 3350018 [Uncensored] Suzu-chan, A Natural Erotic Girl Who Is Very Popular In The Street, A Good Girl Who Gently Interacts With A Suspicious Masked Old Man, And Cums In Her Slender Pussy! FC2-PPV-3350018

  • amateur uncensoredcreampieamateur
    • 2023-05-20
    59 min

    HEYZO-3055 Momoko Tanaka [Tanaka Momoko] Please Look At The Foolishness Of The Girl!

  • momoko tanaka uncensoredcreampiemarried woman
    • 2023-05-20
    243 min

    NACX-121 Fucking And Piling Cowgirl Blame! 14 Colossal Tits Sluts

  • misono waka tomoko kamisaka censoredslutNACXplanet plusshichidomeNACX-121NACX121h-237nacx00121
    • 2023-05-19
    190 min

    SSIS-718 A Spider Masochistic Sexual Feeling That Makes A Maso Man Who Can"t Move Entwined With Long Limbs Absolutely Fires Ichika Hoshimiya

  • ichika hoshimiya censoredslutsingle workSSISs one number one stylenanzaki masakis1 no 1 styleSSIS-718SSIS718ssis00718
    • 2023-05-19
    132 min

    SSIS-714 Intersecting Body Fluids, Dense Sex Completely Uncut Special Kokoro Utano

  • utano kokoro censoredbeautiful girlsingle workSSISs one number one stylecrests1 no 1 styleSSIS-714SSIS714ssis00714
    • 2023-05-19
    240 min

    CJOB-130 I"m Surrounded By Sluts And Sandwiched And Ejaculated At The Same Time BEST

  • ichika matsumoto sumire kuramoto censoredcreampieCJOBslut havenslut haven bestCJOB-130CJOB130cjob00130
    • 2023-05-19
    59 min

    HEYZO-3054 Mio Futaba [Mio Futaba] My Lover Who Is Too Awesome-I"ll Give You Lots Of Love!

  • futaba mio uncensoredcreampie
    • 2023-05-19
    170 min

    HUNTB-563 "Today Is A Dangerous Day. Still Want To Have Sex？ Don"t You Have The Courage To Do That？" My Sister-in-law And I, Who Are Trying To Dodge With Adult Margins, Have Sex With A High Risk Degree MAX Implantation Rate!

  • censoredcreampiesisterHUNTBhunterkawajirihhh groupHUNTB-563HUNTB563huntb00563
    • 2023-05-19
    180 min

    CJOD-384 GOto Affair Travel Colossal Tits Celebrity Wife And Rich Father"s Cream Pie Romance Tachibana Mary

  • tachibana mary censoredcreampiesingle workCJODslut haventrendy yamaguchiCJOD-384CJOD384cjod00384
    • 2023-05-19
    240 min

    HUNTB-559 In The Morning, I Will Leave On A Flight... At Least Until That Time... I Forgot Myself And Loved My Older Childhood Friend And Intense Sex. She Fulfilled Her Dream Of Becoming A CA She Moved Far Away

  • censoredcreampieHUNTBhunterkawajirihhh groupHUNTB-559HUNTB559huntb00559
    • 2023-05-19
    130 min

    HMN-390 Protein (Semen) Desires Unstoppable Deca-Ass Trainer Squeezed Many Shots At Stakeout Woman On Top Posture Chintre Chanyota

  • chanyota censoredcreampieslutHMNbookhimopan of joytoyHMN-390HMN390hmn00390
    • 2023-05-19
    180 min

    SSIS-681 You Masochistic Men Want To Be Raped By A Saba-Saba Girl, Right？ Slut Genius Yura-chan Delivered To M Man"s House 1 Night 2 Days 6 Shots Ejaculation Document Yura Kano

  • yura kanno censoredbeautiful girlslutSSISs one number one stylenanzaki masakis1 no 1 styleSSIS-681SSIS681ssis00681
    • 2023-05-19
    240 min

    CJOB-129 "I"m Already Out In The Middle~" 90 Deca-ass Piled Cowgirls! BEST

  • ichika matsumoto julia censoredcreampieslutCJOBslut havenslut haven bestCJOB-129CJOB129cjob00129
    • 2023-05-19
    120 min

    HMN-384 I Have A Boyfriend That I Love, But... Your Cock Is The Best Choice. Minami Sawakita

  • sawakita minami censoredcreampiebeautiful girlHMNbooknanzaki masakiHMN-384HMN384hmn00384
    • 2023-05-19
    120 min

    SSIS-692 "Isn"t It Embarrassing To Be Bullied By A Younger Girl？ Lol" A Girl Who Knows Her Boobs Are A Weapon Is A Disqualified Teacher Who Lost Reason To Her Students" Big Tits Sweet Sad Explosive Nuki Reverse Corporal Punishment Yuu

  • adachi yuri censoreduniformslutSSISs one number one stylethere is alsos1 no 1 styleSSIS-692SSIS692ssis00692
    • 2023-05-18
    38 min

    fc2-ppv 3340458 This Is What Happens When A Real Dancer Has Sex, A Large Amount Of Vaginal Cum Shot With A Violent Cowgirl With A Beautiful Buttocks And The Best Proportions FC2-PPV-3340458

  • amateur uncensoredcreampie
    • 2023-05-18
    130 min

    FANH-142 Cheating Addicted Frustrated Wife Takako 32 Years Old Seeding Raw Insertion 3P Delightful Continuous Convulsions Climax Extreme Thick Ji Po Completely Fallen Pies Begging Ma Co

  • censoredcreampiesquirtingFANHhamedori.network secondeditionFANH-142FANH142h-1472fanh00142



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download