to




FC2AVSASTARSNGODCAWDHZGDCESDMEYDFSDSSLULUROYDCHRVMILKPREDDTTWAAAHNDNATRVEMASSISJUFE

2021-01-20
99 min

[VNDS-3356]With My Wife's Sister Who Came To Take Care Of Me While My Wife Was Away... Yamaguchi Tsubaki

  • satoshi yamaguchi censoredcreampiemature womanVNDSstar paradisenext toilet r eVNDS-3356VNDS3356h-254vnds03356
    • 2021-01-20
    42 min

    FC2PPV 1652394 [No] [Limited to 100 pieces 1000pt OFF!] 2 consecutive vaginal cum shots for active idols ♥ ️ Shortcut slender loli beautiful girl ♥ ️ Complete appearance raw vaginal cum shot sex lifted! ♥ ️ * Review benefits / Gokkun Blow while elect

  • amateur uncensoredfc2
    • 2021-01-20
    120 min

    [GVH-184]She Doesn't Want To Waste Any Semen, So She'll Lick It All Down For A Cum Swallowing Good Time! This Semen-Saver Mama Is Not Wasting Any Tissues And Helping Out The Environment Yuri Sasahara

  • yuri sasahara censoredslutmomGVHglory questkabin kizakuraGVH-184GVH18413gvh00184
    • 2021-01-20
    39 min

    FC2PPV 1652991 [Personal shooting] Former model’s high-handed bride is made to fall asleep by a strong boss and is fucked by another stick while crying … Drowning in another person’s juice

  • amateur uncensoredfc2
    • 2021-01-20
    49 min

    FC2PPV 1651965 [Beautiful wife NTR, I will expose it without appearance w] I forced a beautiful wife to conceive and SEX, but it was lewd, so the video w when I conceived it again is too erotic w

  • amateur uncensoredfc2
    • 2021-01-20
    130 min

    [GVH-181]I'm Your Sex Pet... You Can Order Me To Do Whatever You Want, And I'll Obey... Awakening As A Sub Urara Kanon

  • hanaoto urara censoredbdsmsingle workGVHglory questGVH-181GVH18113gvh00181
    • 2021-01-20
    118 min

    [OFKU-172]The Bride's Mother Who Came To Tokyo From Miyagi... 50-something Stepmom - Rumi Nitta

  • rumi nitta censoredcreampiemature womanOFKUstar paradisemom railOFKU-172OFKU172h-254ofku00172
    • 2021-01-20
    53 min

    FC2PPV 1652623 Iki crazy woman] Nerima G cup busty wife 25 years old [20,000 yen a day, monitor recruitment] Wife who came to the adult toy test pretending to be serious. When she shows a big cock, she immediately falls. She has convulsions acme many

  • amateur uncensoredfc2
    • 2021-01-20
    99 min

    [MOKO-033]If You Show Your Cock To A Beautiful Mature Woman In A Private Men's Mature Woman...

  • censoreduniformamateurMOKOstar paradisebumpy roadMOKO-033MOKO033h-254moko00033
    • 2021-01-20
    180 min

    [MOKO-034]"Please Don't Tease Me, I'm Going To Want To Fuck..." This Cleaning Lady Had A Voluptuously Nice Ass, So When I Relentlessly Began To Fondle It... 180 Minutes

  • censoredamateurblowjobMOKOstar paradisebumpy roadMOKO-034MOKO034h-254moko00034
    • 2021-01-19

    FC2PPV 1651640 [Individual shooting 172] Saddle contact ♡ Super body with a height of 171 cm ♡ Creampie to a beautiful nurse who is a married woman and does not seem to be a mother of two children

  • amateur uncensoredfc2
    • 2021-01-19
    47 min

    FC2PPV 1651388 * Limited time 2980⇒1400pt! ☆ Creampie processing toys ♥ Unmarried pregnant woman ♥ Mr. Haneda 33 years old is back! ☆ Dirty pregnant woman who rolls up every day even though it is close to childbirth ♥ Lustful pussy is sensitive ♥ mer

  • amateur uncensoredfc2
    • 2021-01-19
    141 min

    [SDTH-001]Cheerful Cum-Guzzling Sub Slut. She Loves Sex More Than Money - This Amateur Starred In Porn To Get Fucked. Upscale Real Estate Agent Working In Tokyo For Two Years - Cum Swallowing Yuki Mishima (Pseudonym - Age 23) Her One-Night, Two-Day P

  • censoredSDTHsod createietaroeromanceSDTH-001SDTH0011sdth00001
    • 2021-01-18
    27 min

    FC2PPV 1649150 [4K] ≪Complete appearance≫ Intensely cute whitening & beautiful busty girl (20) ❤ Finger piston pussy dochudchu ~ While saying embarrassing, I’m excited to see it for the first time! Intrinsic lewdness that will stop and cum!

  • amateur uncensoredfc2
    • 2021-01-18
    44 min

    FC2PPV 1650119 [First time limited 1980] Natural G cup that seems to break ❤️ I like H better than masturbation ❤️❤️ A gift of sperm with plenty of big cock butycomi to a nervous and stiff fair-skinned busty girl ❤️❤️

  • amateur uncensoredfc2
    • 2021-01-17
    57 min

    413INST-088 From Archangel to God! Legal Lori Paipan daughter who was an active idol and 3P personal shooting SEX [amateur / personal shooting]

  • amateur censoredcreampieamateurinstinst-088inst088413inst-088
    • 2021-01-17
    176 min

    [MMYM-042]Slut With Huge Tits Gets You To Make Her Cum With Dirty Talk - Filthy Words - Chitose - Chitose Yuki

  • chitose in the evening censoredbig titsslutMMYMmarrionaida yumenoyumenoMMYM-042MMYM042mmym00042
    • 2021-01-17
    237 min

    [SORA-290]*Super Rare Extreme Freaks *Exhibitionist S********ls Broadcasting Live! Shocking Horny Teens' Vibrator Masturbation! Will They Go All The Way With A Real Creampie？!

  • censoredschoolgirlSORAyama to soratelephone poleSORA-290SORA290sora00290
    • 2021-01-17
    151 min

    [CHCH-003]Due To Corona This Brothel Babe Is Running A Soapland Right Out Of Her Own Home! - Voluptuous Curves, Incredible Sex SK**ls, And Comfortable, Caring Services Make Her The Talk Of The Town -

  • censoredbig titsamateurCHCHmilk and moms emmanuellemilk and momsCHCH-003CHCH003chch00003
    • 2021-01-17
    133 min

    [KTKC-105]I Never Expected My Stepdaughter To Be Such A Busty Little Succubus. Hinata

  • censoredbig titsamateurKTKCkitixx mousouzokubig titsKTKC-105KTKC105ktkc00105
    • 2021-01-17
    25 min

    FC2PPV 1649040 [Beautiful girl’s wall push! ] Small animal girl Kanon-chan shock debut! I couldn’t stand it because it was too cute and I tried to insert it raw without permission even after ejaculation!

  • amateur uncensoredfc2
    • 2021-01-17
    105 min

    300MIUM-672 [I want to put raw chin in this ass! First place] Is it legally okay？ ？？ Rent a worried Lori beautiful girl as her! Completely REC the whole story that was spoiled up to the originally prohibited erotic acts by persuading! !! After enjoyi

  • amateur censoredcreampieamateurmiummium-672mium672300mium-672
    • 2021-01-17

    FC2PPV 1648961 Limited to 3 days [Individual shooting] Slender thirty wife, sobbing with another stick and vaginal cum shot twice

  • amateur uncensoredfc2
    • 2021-01-17
    134 min

    [SORA-291]Infidelity Is Her Hobby - Faithless Wife Squirting For Adulterous Fucks - This Serial Cheater's Pussy Is Drenched. Adultery Trip With Her Fuck Buddy Right Under Her Husband's Nose. This Shocking Exhibitionist Cums 34 Times Before Sh

  • censoredSORAyama to sorahimu lockSORA-291SORA291sora00291
    • 2021-01-17
    81 min

    FC2PPV 1648847 I tried vaginal cum shot to my senior who works part-time.

  • amateur uncensoredfc2
    • 2021-01-16
    67 min

    FC2PPV 1643640 [No / Piece] Small cute drunk OL selfie Gonzo !？ After the secret year-end party of the year, bring seniors to the hotel and super rich vaginal cum shot SEX !! * There is a face-up review privilege

  • amateur uncensoredfc2
    • 2021-01-16
    49 min

    FC2PPV 1646670 [Uncensored / No Mo] Buyer review benefits available (High-quality version) _ [It’s not bad to take it off] Misa (Rise, Meru) / 20 years old / College student [Complete appearance] Clothed raw SEX

  • amateur uncensoredfc2
    • 2021-01-16
    240 min

    [HUNBL-029]Girls G*******ged In Their Own Homes By Intruders Until They Stop Resisting - Made To Take Creampie After Creampie

  • censoredcreampieHUNBLhunteraldebaranhhh groupHUNBL-029HUNBL029hunbl00029
    • 2021-01-16
    130 min

    [ROYD-039]My Stepsister Is Down To Fuck So Long As I've Got A Condom! Only I Forgot My Promise To Put It On And Ended Up Stealthing Her For Raw Sex! Natsu Tojo

  • natsu tojo censoredcreampiesisterROYDroyalkawajirihhh groupROYD-039ROYD039royd00039
    • 2021-01-16
    120 min

    [MVSD-450]A Fated Dual Affair With The New Girl About To Resign From Work To Get Married - My Last Round Of Passionate, Creampie Sex With My Lover Before I Leave The Office Akari Neo

  • akari neo censoredcreampieslutMVSDm s video groupMVSD-450MVSD450mvsd00450
    • 2021-01-16
    65 min

    FC2PPV 1647677 * Limited time 2980⇒1400pt! ★ Intense hot cum shot 3P orgy with devilish pleasure ♥ Miya-chan & Yukino-chan ② ☆ On the verge of exploding to a perverted blame ♥ Thick double blowjob with patience juice ♥ Reasonable raw vaginal cum

  • amateur uncensoredfc2
    • 2021-01-16
    160 min

    [JJBK-039]Mature Woman Babes Only A Mature Woman Came To My Room So We Took Her Home For A Peeping Good Time And Then We Sold The Footage As An Adult Video 37 Horny Mature Woman Babes Who Use Their Tall Bodies And Beautiful Colossal Tits To Fuck Male

  • censoredmature womanslutJJBKjukujo bank emmanuellemanji groupJJBK-039JJBK039jjbk00039
    • 2021-01-16
    113 min

    [ROYD-037]I Confessed My Love For The First Time To The No.1 Slut At School! "If We're A Good Match Sexually, I'll Go Out With You!" And Then She Gave My Cherry Boy Cock A Test Ride! Yui Kawai

  • yui kawai censoredcreampieschoolgirlROYDroyalcognac kaminohhh groupROYD-037ROYD037royd00037
    • 2021-01-16
    182 min

    [DVDMS-621]I Want To Fuck My Big Tits Big Stepsister... This Little Stepbrother Confessed His Warped Desires For His Big Stepsister And After Much Conflict, She Accepted Mei Satsuki

  • satsuki mei censoredcreampiebig titsDVDMSdeep sgreenhouse effectDVDMS-621DVDMS621dvdms00621
    • 2021-01-16
    51 min

    FC2PPV 1647696 [Individual shooting] Connected to the dangerous back dirt J system famous for SNS and immediately squirrel halo ・ I can not stand it with more erotic pussy than rumors

  • amateur uncensoredfc2
    • 2021-01-16
    33 min

    FC2PPV 1641101 [Personal shooting] Kana 20-year-old shaved beauty! It is a vaginal cum shot to an elegant neat and sexy beauty who can not be thought of as 20 years old!

  • amateur uncensoredfc2
    • 2021-01-16
    169 min

    [HUNBL-030]"I Wanna Get Dirty..." Sluts At A Labor Camp To Fuck The Filthy Workers Hard.

  • censoredbukkakeHUNBLhunteraldebaranhhh groupHUNBL-030HUNBL030hunbl00030
    • 2021-01-16
    239 min

    [HUNTA-932]She Brought A Video Camera Along On Our First Date To Remember It By, But When We Got Grabbed By A Couple Of Street Toughs They Used It To Record Fucking Her. I Was So Scared I Couldn't Move A Muscle...

  • censoredcreampieHUNTAhunterspace nyanjirohhh groupHUNTA-932HUNTA932hunta00932
    • 2021-01-16
    30 min

    FC2PPV 1647094 30 minutes to blame Yukopi who likes naughty movement

  • amateur uncensoredfc2
    • 2021-01-16
    232 min

    [HUNTA-931]"You Need To Peel Back Your Foreskin And Wash It Carefully, Okay？" 3 - My Older Stepsister Always Treats Me Like A K*d, Including Telling Me How To Take Care Of My Dick

  • censoredcreampiebig titsHUNTAhuntermorikihhh groupHUNTA-931HUNTA931hunta00931
    • 2021-01-16
    191 min

    [HUNTA-926]My Sister-In-Law Is Always Waiting For My Big Brother To Come Home After Working Overtime, Late Into The Night, And Since She's Super Horny, I'm Always Fucking Her Brains Out For 8 Hours At A Time Until He Returns Home.

  • censoredcreampieHUNTAhunterkawajirihhh groupHUNTA-926HUNTA926hunta00926
    • 2021-01-16
    119 min

    [ROYD-040]Made To Give My Own Slutty Niece Creampie After Creampie Until My Balls Are Drained Dry... Uta Yumemite

  • yumemi teruuta censoredcreampieschoolgirlROYDroyalcognac kaminohhh groupROYD-040ROYD040royd00040
    • 2021-01-16
    119 min

    [SSNI-971]Forbidden To Masturbate For One Whole Month, She's Transformed Into A Raging Horny Slut! Extreme Squirting Nympho FUCK Hiyori Yoshioka

  • hiyori yoshioka censoredsquirtingbeautiful girlSSNIs1 no 1 stylemon cSSNI-971SSNI971ssni00971
    • 2021-01-16
    198 min

    [HUNTA-928]It's Close To Work, So My Beautiful Bosses Use My Place As A Pit Stop When They Miss The Last Train! They've Got Beautiful Legs, Godly Ass, And Look Nut-Bustingly Gorgeous In Black Pantyhose... Did I Mention They're Horny As He

  • censoredcreampieHUNTAhuntercognac kaminohhh groupHUNTA-928HUNTA928hunta00928
    • 2021-01-16
    70 min

    FC2PPV 1646723 [Individual shooting / No / Conceived NTR 2nd round w] I came to see my fiancée with a smile during the wedding ceremony / new house search date, so I injected two seeds and returned to my fiancée w And NTRSEX Shitoruyan w

  • amateur uncensoredfc2
    • 2021-01-15
    37 min

    FC2PPV 1646126 [Personal shooting / Creampie] At the age of 40, sexual desire reaches its peak. I want to confirm myself as a woman, not as a wife …

  • amateur uncensoredfc2
    • 2021-01-15
    86 min

    277DCV-174 Is it okay to send it home？ case.168 2021 New Year Celebrity SP! Dominate the world with a child actor! Former idol who has appeared in many famous youth dramas! ⇒ After all, idols are super cute! Facial deviation value 70 or more Safe ful

  • amateur censoredsquirtingamateurdcvdcv-174dcv174277dcv-174
    • 2021-01-15
    55 min

    FC2PPV 1642427 [No] Irresponsible vaginal cum shot to a loosely fluffy married woman! A pant voice with a cute smile, a frustrated and craving for a dick, and a vaginal cum shot from raw insertion! 【selfie】

  • amateur uncensoredfc2
    • 2021-01-15
    94 min

    FC2PPV 1644949 980 yen! Non-chan training diary ① “Doujin AV debut” A neat cosplayer will scream to Ahea with naughty ♪! 21-year-old JD3 Non-chan who challenges shooting with bruises in a dangerous play even in private Chapter 1

  • amateur uncensoredfc2
    • 2021-01-15
    160 min

    [MDBK-152]I'll Fuck You A Door-To-Door Slut Counselor Is Giving A Work-At-Home Man Some Totally Sexual Health Care

  • satomi yuria akari shinmura censoredbig titsslutMDBKbazookak taroMDBK-152MDBK152h-1496mdbk00152
    • 2021-01-15
    86 min

    [YMDS-013]A Delivery Gal! It's A SK**ls Challenge To See How Many Cum Shots She Can Fire Off! Ran Tsukishiro A Death Match To See How Many Cum Shots She Can Ejaculate!

  • ran tsukishiro censoredcreampiehandjobYMDSmomotaro video publishinghimrockyoung peachYMDS-013YMDS013ymds00013
    • 2021-01-15
    80 min

    FC2PPV 1646453 [First time limited 1980] Club picked up club love active JD ❤️ I was allowed to take a gonzo when I was in contact ❤️ Full erection with self-Irama ❤️ A large amount of vaginal cum shot with a meat stick woofer ❤️

  • amateur uncensoredfc2
    • 2021-01-15
    47 min

    FC2PPV 1645865 [Personal shooting] Ginza club mom raises funds to protect the store Enko! Raw insertion cum shot in glamorous big ass

  • amateur uncensoredfc2
    • 2021-01-15
    122 min

    [SUPA-564]I Cut Class To Go A Hotel SAKURA

  • censoredschoolgirlamateurSUPAskyu shirotokaoruSUPA-564SUPA564h-244supa00564
    • 2021-01-15
    83 min

    [XRW-964]I Gave a Bukkake To A Tipsy College Girl As A Prank At A Camp Site

  • censoredXRWreal worksreal real worksXRW-964XRW964172xrw00964
    • 2021-01-15
    239 min

    [NASH-436]"Do You Want To Fuck An Old Lady Like Me!？" A Mature Woman Who Plunges Into A Deep And Rich Love Affair With Her Friend's Son (Who Is Much Younger Than Her), Or Her Daughter's Husband

  • mika ichijo saki mizumi censoredbig titsmarried womanNASHpinknadeshikoNASH-436NASH436h-067nash00436
    • 2021-01-15
    54 min

    [EMOI-043]Going To Tokyo, Picking Up Guys And Making Them Lose Their Virginity. I Told You Osaka Girls Were Hot. Tsukino Nonomiya/An Erotic Girl.

  • tsukino nonomiya censoredbig titsEMOIsod createtiger gavelemo girlEMOI-043EMOI0431emoi00043
    • 2021-01-15
    66 min

    [YMDS-015]A Delivery Gal! It's A SK**ls Challenge To See How Many Cum Shots She Can Fire Off! A Death Match To See How Many Cum Shots Ayuka Kuroda Can Ejaculate!

  • ayuka kuroda censoredcreampiehandjobYMDSmomotaro video publishinghimrockyoung peachYMDS-015YMDS015ymds00015
    • 2021-01-15
    241 min

    [MDTM-698]This Sparkling S********l Who Is Sensually Sensitive To Fashion And Sex Is Working At An Excessively Dangerous Underground Part-Time Job 2

  • censoredcreampieuniformMDTMuchu kikakutetMDTM-698MDTM698h-585mdtm00698
    • 2021-01-15
    205 min

    [BAZX-266]The Total Domain Of A Beautiful Y********l In Uniform Who Wants To Be Watched What A Slut vol. 002

  • censoredcreampieuniformBAZXbazookatodoBAZX-266BAZX266h-1496bazx00266



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download