slut creampie jav sister censored




FC2ABWSPRDAVSAMIAACESDMILKHDKASSISNATRSSNIWANZKBIHNDONEZAMBIFSDSSVENXDASDDTTAUKG

2023-06-30
120 min

BF-687 When I Called Deriheru, Her Older Sister Came! "Don"t Tell Her Sister, Instead... Let Me Cum Inside You" Hinako Mori

  • hinako mori censoredcreampiebig titsBFbefreeBF-687BF687bf00687
    • 2023-06-30
    130 min

    MIDV-407 "I"ll Leave This House Tomorrow." That"s Right... Then Today, Let"s Have The Last Sex. She Dated Her For 7 Years And Was Slutted Like She Was A Virgin For 3 Days Before She Moved. Jinguji Nao

  • jinguji temple nao censoredcreampieslutMIDVmoody sthere is alsomoodyz divaMIDV-407MIDV407midv00407
    • 2023-06-24
    139 min

    EKDV-710 [4K] My Girlfriend"s Older Sister Turned Me Into A Slut... My Beautiful Older Sister Who Has An Outstanding Style And Is A Carnivore, And While She Was Away, I Was Fucked Many Times And I Was Boned In A Woman On Top Posture. Amakawa Sora

  • tenkawa sora censoredcreampiesquirtingEKDVcrystal picturepearl rice sakagamie kissEKDV-710EKDV710ekdv00710
    • 2023-06-24
    111 min

    AVSA-251 Perverted Bimbo Ring Meat Urinal Saaya Kirijo

  • kirijo saaya censoredcreampieslutAVSAavs collector sbuddha davscollector sAVSA-251AVSA251avsa00251
    • 2023-06-23
    131 min

    CKW-001 It"s Always Decided To Be Called During The Lunch Break. But... Ejaculation Is 9 Hours Later. Moreover, It Is Blamed Immediately After That. And In The End, The Rapid-fire Sex Sato"s？

  • is it sato momoka kato censoredcreampieslutCKWwarp entertainmentk westcobra warpCKW-001CKW0012ckw00001
    • 2023-06-23
    150 min

    CJOD-388 Naughty Older Sister Comes To Slut Creampie OK Rejuvenated Asian Men"s Esthetic Kana Morisawa

  • kana morisawa kanako iioka censoredcreampieslutCJODslut havenhiroharu osakiCJOD-388CJOD388cjod00388
    • 2023-06-23
    300 min

    SKMJ-404 Sandwiched Between Horny Sluts Who Have Awakened Estrus Simultaneously Torture All Erogenous Zones Reverse 3P Harem Hedonism"s Early Transformer BDSM Plenty Pulled Out 10 Pairs 5 Hours 35 Ejaculation

  • censoredcreampiebig titsSKMJblush girlSKMJ-404SKMJ404h-1324skmj00404
    • 2023-06-23
    135 min

    HODV-21775 With Indecent Sighs And Moist Eyes, I"ll Lick You A Lot... Insert A Lot... Toro Face Begging Fellatio Ruisa Tsuzuki

  • tsuzuki ruisa censoredcreampieslutHODVh m pk c takedaHODV-21775HODV217755642hodv21775
    • 2023-06-23
    139 min

    HODV-21774 While My Wife Was Traveling With Her Friend, I Trained My Wife"s Younger Sister, Who Is Obnoxious And Weak To Push, To Be A Meat Masturbator Hikaru Minazuki

  • hikaru minazuki censoredcreampiebeautiful girlHODVh m pbottomsHODV-21774HODV217745642hodv21774
    • 2023-06-17
    73 min

    230ORECO-329 Iori And Hitomi

  • amateur censoredcreampiebig titsorecooreco-329oreco329230oreco-329
    • 2023-06-16
    138 min

    406FTK-010 「お祝いだから生でしてあげる」痴女家庭教師が淫語で誘惑！M字騎乗位で搾精筆おろし

  • amateur censoredcreampieamateurftkftk-010ftk010406ftk-010
    • 2023-06-14
    29 min

    230ORECO-327 Iori

  • amateur censoredcreampiebig titsorecooreco-327oreco327230oreco-327
    • 2023-06-16
    150 min

    JUNY-094 The Hidden Obscene Propensity Of The Older Sister Who Has Been Longing For A Long Time! Showing Off Her Smelly Ass Hole And Licking Her Plump Big Ass Human Bullet Temptation Reo Fujisawa

  • reo fujisawa censoredanalcreampieJUNYfitchnikuyokuJUNY-094JUNY094juny00094
    • 2023-06-09
    195 min

    BANK-126 Huge Breasts Hot Spring Slut Sister J Cup I Cup

  • maki kyoko suwon miso censoredcreampiesisterBANKmako banktake chanBANK-126BANK126h-1495bank00126
    • 2023-06-09
    120 min

    IPZZ-052 Unexpected Wedding On The Best Day Of My Life Reverse NTR A Beautiful Wedding Planner Who Steals The Bride"s Eyes And Secretly Seduces The Groom Tsumugi Akari

  • akari tsumugi censoredcreampieslutIPZZidea pockettissueIPZZ-052IPZZ052ipzz00052
    • 2023-06-08
    125 min

    IENF-268 When I Was Playing A Prank On My Sleeping Schoolgirl Sister, She Asked Me For Raw Fucking, And Though I Was About To Ejaculate, She Was Locked With Crab Scissors And Couldn"t Escape, And I Couldn"t Get Away And Creampied Her! 9

  • minase akari natsuka censoredcreampieschoolgirlIENFi energyienfIENF-268IENF2681ienf00268
    • 2023-06-02
    140 min

    MIAA-860 Reiwa Genius Icchan？ Hata-chan, The Genius Of The Showa Era？ AV World W Genius Slut Harlem! ! You Don"t Need A Script! With Ad-lib Dirty Words And Amazing Techniques, You Can Win An Easy Victory In 5 Seconds! A Luxury Reverse 3P Creampie

  • yui hatano ichika matsumoto censoredcreampiebeautiful girlMIAAmoody stiger gaveleveryone s kikatanMIAA-860MIAA860miaa00860
    • 2023-05-27
    233 min

    FGEN-001 Nasty Slut Who Squeezes Out Sperm Eimi Fukada

  • emi fukada censoredcreampieslutFGENfirst starf generateFGEN-001FGEN001h-491fgen00001
    • 2023-05-25
    121 min

    IENF-242 My Beautiful Older Sister Who Felt Pity For Me, Who Didn"t Have Any Sae, Promised To "Just Rub Me" And Had Intercrural Sex With Me, But It Was Too Pleasant For Each Other And My Pussy Was Dripping! Raw Insertion Null! "Huh？ I

  • chanyota sakura tsuji censoredcreampieslutIENFi energyienfIENF-242IENF2421ienf00242
    • 2023-05-19
    170 min

    CJOD-386 Big Ass Older Sister Comes To A Slut Creampie OK Rejuvenated Asian Men"s Esthetic Alice Oto

  • otsu alice censoredcreampieslutCJODslut havenhiroharu osakiCJOD-386CJOD386cjod00386
    • 2023-05-19
    130 min

    HMN-390 Protein (Semen) Desires Unstoppable Deca-Ass Trainer Squeezed Many Shots At Stakeout Woman On Top Posture Chintre Chanyota

  • chanyota censoredcreampieslutHMNbookhimopan of joytoyHMN-390HMN390hmn00390
    • 2023-05-12
    240 min

    PBD-441 I Was Slutty By Piling Up 60 Shots In The Riding Position That I Could See My Beautiful Older Sister'S Buttocks... Best

  • aika yamagishi karen kaede censoredcreampieslutPBDpremiumpremium bestPBD-441PBD441pbd00441
    • 2023-05-06
    135 min

    EKDV-705 I Was Slutty At The Sight Of My Girlfriend... I Was Totally Addicted To Having Sex With My Busty, Slutty, And Slutty Sister Many Times While I Was Away. Tsukino Kasumi

  • kasumi tsukino censoredcreampieslutEKDVcrystal picturepearl rice sakagamie kissEKDV-705EKDV705ekdv00705
    • 2023-05-06
    141 min

    BAGR-016 Ichijo Mio, A Slutty Sister Who Distorts Her Otaku Brother'S Friendship And Sexual Habits

  • ichijo mio censoredcreampieschoolgirlBAGRbaltan baltanminimal rock villagesex beast girlBAGR-016BAGR016bagr00016
    • 2023-05-06
    175 min

    GVH-538 Misaki Kanna Continued To Have Match Pump Ejaculation Management By Her Older Sister Kanna, Who Knew About My Masturbation Ban, With Impatient Staring And Fellatio Where Ejaculation Was Prohibited Many Times [Ruined Ejaculation] For 5 Days Mi

  • kanna misaki censoredcreampieslutGVHglory questharuka yukioGVH-538GVH538gvh00538
    • 2023-05-06
    97 min

    KTRA-522 Provocation! Little Devil Lolivich 05 Mashiro Minori

  • mashiro minori censoredcreampieslutKTRAk tribeKTRA-522KTRA522ktra00522
    • 2023-05-05
    125 min

    FOCS-128 My Little Sister'S Boyfriend Is A Bitchy Gal, My Sister Has Reverse Ntr Creampies, Immoral Sex, Herbivorous Boys Are Unbearable! (^P^) Hana Took It Delicious Shibuya Hana

  • shibuya hana censoredcreampieslutFOCSabc delusion groupfocusFOCS-128FOCS128focs00128
    • 2023-05-05
    127 min

    FOCS-126 “I'M Always So Excited That My Underpants Get Wet...” The Literary Older Sister Is Addicted To Dangerous Play, And Is Addicted To Dangerous Play, And Is Addicted To Dangerous Play, Suehiro Jun

  • suehiro jun censoredcreampieslutFOCSabc delusion groupfocusFOCS-126FOCS126focs00126
    • 2023-05-05
    160 min

    IPZZ-058 Men Who Were Slutty 24 Hours A Day At A Hotel By A Beautiful Older Sister “From The Bottom Of My Heart...” Were Squeezed Out And Screwed. Nakamura Miu

  • miu nakamura censoredcreampieslutIPZZidea pocketzampatissueIPZZ-058IPZZ058ipzz00058
    • 2023-04-29
    160 min

    GVH-536 Masochist Male Dude Raised By Menhera'S Body Fluids While Confined By Her Sister Who Is A Relentless Landmine Idol ● Chemical Training Yokomiya Nanami

  • yokomiya nanami censoredcreampieslutGVHglory questham the mcGVH-536GVH536gvh00536
    • 2023-04-28
    122 min

    HODV-21759 My Girlfriend'S Older Sister, Who Doesn'T Have A Lot Of Sexual Desire, Runs Wild With Her Plump Big Butt! I Was Slutty By Piling Up Pile All The Time, And It Went On Me! Taki Yuina

  • taki yuina censoredcreampieslutHODVh m pk c takedaHODV-21759HODV217595642hodv21759
    • 2023-04-28
    150 min

    CAWD-534 My Friend Went To The Countryside For Summer Vacation, And I Was Sacrificed By My Two Younger Sisters Who Never Did Anything, And My Sperm Was Uprooted And Squeezed Out Of My Youth Pussy. Kuramoto Sumire Hyuga Yura

  • sumire kuramoto hyuga yura censoredcreampieschoolgirlCAWDkawaiitake dCAWD-534CAWD534cawd00534
    • 2023-04-28
    180 min

    HODV-21760 Boobs Come To The Cock Of A Beautiful Older Sister Who Lives In The Same Apartment Sanda Sakura

  • mita sakura censoredcreampieslutHODVh m pHODV-21760HODV217605642hodv21760
    • 2023-04-21
    176 min

    HMN-362 A Reverse Take-Out Creampie Date With A Senior Who Lets Me Fuck You Raw If You Entertain Himself Hinako Mori

  • hinako mori censoredcreampieslutHMNhon nakaHMN-362HMN362hmn00362
    • 2023-04-21
    146 min

    HMN-378 Beautiful Face Older Sister Tojo Natsu Who Secretly Removes The Condom And Covers It Without Showing The Insertion Part And Grinning Berokisu Cowgirl Who Loves Raw Vaginal Cum Shot

  • natsu tojo censoredcreampieblowjobHMNhon nakaHMN-378HMN378hmn00378
    • 2023-04-21
    178 min

    AKIB-017 Reprinted Thanksgiving Price 1980 Yen Female College Student Only After Drinking Party, Take It Back To The Room, Voyeur And Silently Go To AV No.37 Sexy Older Sister JD Creampie Kumi / J Cup / 21 Years Old (Tall 170cm, Sexy Older Sister Pie

  • amateur censoredslutAKIBone night stand mature woman gammadionAKIB-017AKIB017akib00017
    • 2023-04-21
    210 min

    CJOD-377 Double Delivery To M Man Kun"s House (Uchi) Colossal Breasts Older Sister Chitose Yuuki Kyoko Maki

  • chitose in the evening maki kyoko censoredcreampiebig titsCJODchijo heavenCJOD-377CJOD377cjod00377
    • 2023-04-19
    40 min

    IENFH-107 My Beautiful Older Sister Who Felt Pity For Me, Who Wasn"t Sae, Promised To "Just Rub Me" And Had Intercrural Sex With Me, But It Was Too Pleasant For Each Other And My Pussy Was Dripping! Raw Insertion Null! "Huh？ Is It In？

  • yuki mishima censoredcreampieslutIENFHienergyIENFH-107IENFH107
    • 2023-04-19
    40 min

    IENFH-109 My Beautiful Older Sister Who Felt Pity For Me, Who Wasn"t Sae, Promised To "Just Rub Me" And Had Intercrural Sex With Me, But It Was Too Pleasant For Each Other And My Pussy Was Dripping! Raw Insertion Null! "Huh？ Is It In？

  • chan yota censoredcreampieslutIENFHienergyIENFH-109IENFH109
    • 2023-04-19
    41 min

    IENFH-108 My Beautiful Older Sister Who Felt Pity For Me, Who Wasn"t Sae, Promised To "Just Rub Me" And Had Intercrural Sex With Me, But It Was Too Pleasant For Each Other And My Pussy Was Dripping! Raw Insertion Null! "Huh？ Is It In？

  • sakura tsuji censoredcreampieslutIENFHienergyIENFH-108IENFH108
    • 2023-04-14
    116 min

    MIMK-115 Yuria Yoshine Sensual Older Sister Who Seduces Pure Shota With Her Too Plump Body Yuria Yoshine

  • yoshine yuria censoredcreampiebig titsMIMKmoodyzMIMK-115MIMK115mimk00115
    • 2023-04-14
    115 min

    MVSD-542 Her Younger Sister Is A Little Devil Of Ji*pomania, A Monster Girl! Reverse Runaway To Unconscious Chinchilla! Immediate Park Immediate Zubo Semen Vacuum Cowgirl Piston! Ichika Matsumoto

  • ichika matsumoto censoredcreampiebeautiful girlMVSDm 039 s video groupMVSD-542MVSD542mvsd00542
    • 2023-04-14
    122 min

    MIAA-810 A Younger Sister"s Pussy Who Is Teasing Me With A Grinning Panty Shot That Blows Reason And Runs Away Piston Rima Arai

  • lima arai censoredcreampieuniformMIAAmoodyzMIAA-810MIAA810miaa00810
    • 2023-04-08
    120 min

    KTRA-511 I Dote On My Brother Too Much! Lori Sister"s Sweet Slut Yuwaku Ichii Yuka

  • ichika yuka censoredcreampiebeautiful girlKTRAk tribeKTRA-511KTRA511
    • 2023-04-09
    56 min

    230ORECO-278 Kana And Manami

  • amateur censoredcreampiebig titsorecooreco-278oreco278230oreco-278
    • 2023-04-07
    49 min

    230ORECO-276 Kana-san

  • amateur censoredcreampiebig titsorecooreco-276oreco276230oreco-276
    • 2023-03-31
    120 min

    BF-681 My Little Sister, Who Is Too Good At The Cowgirl Position For Her Brother Who Hasn'T Had A Girlfriend For 15 Years, Has An Outbreak, Creampied, Encourage Sex Rio Rukawa

  • nagarekawa rio censoredcreampieslutBFbefreeBF-681BF681bf00681
    • 2023-03-31
    150 min

    JUFE-461 Morisawa Kana'S Vulgar Dirty Talk Whispered With A Sweet Breath While Her Ears Are Licked By An Adult Woman Full Of Sex

  • kana morisawa kanako iioka censoredcreampieslutJUFEfitchyumeno aidaJUFE-461JUFE461jufe00461
    • 2023-03-31
    150 min

    DVEH-003 When It Came To Being Away From Home With My Older Brother'S Girlfriend, Sumire Mizukawa Made Me Do It When She Was Unexpectedly Sloppy Loungewear And She Showed Me Her Brother'S Defenseless Body When She Was Horny

  • mizukawa violet censoredcreampieslutDVEHdeepspearl father jrdeep s 3rd storeDVEH-003DVEH003dveh00003
    • 2023-03-18
    120 min

    SUJI-181 Sibling Squeezing Forbidden Game Enchanting Creampied Sexual Intercourse

  • censoredcreampieslutSUJIkan ran monoadultererSUJI-181SUJI181suji00181
    • 2023-03-17
    240 min

    PBD-437 Best Tane-Squeezing Men'S Esthetic Massage Parlor That Will Let Your Beautiful Older Sister Pamper Your Dick Until You Get Duckling

  • aika yamagishi karen kaede censoredcreampieslutPBDpremiumpremium bestPBD-437PBD437pbd00437
    • 2023-03-17
    110 min

    MIAA-797 A Nice Woman With Beautiful Legs At A Bar In Ebisu. If You Get Drunk By An Older Sister With Beautiful Legs Who Makes You Ejaculate With Her Legs Drunk, Pinch Her Legs, Pinch Her Legs, Pinch Her, And Rape Her, Ageru Mori Hinako

  • hinako mori censoredcreampieslutMIAAmoodyzthere is alsoeveryone s kikatanMIAA-797MIAA797miaa00797
    • 2023-03-03
    101 min

    YSN-593 My New Sister-In-Law Is Devilish, But My Erections Won'T Go Away. Is It Sato'S

  • is it sato momoka kato censoredcreampieslutYSNnonYSN-593YSN593h-127ysn00593
    • 2023-03-03
    140 min

    BF-680 If She Had Free Time, The Plain Big Breasted Older Sister Next Door Would Satisfy Her Frustration With Me. Kirijo Saaya

  • kirijo saaya censoredcreampieslutBFbefreerokuyonBF-680BF680bf00680
    • 2023-02-27
    84 min

    355OPCYN-393 Hina

  • amateur censoredcreampieamateuropcynopcyn-393opcyn393355opcyn-393
    • 2023-02-25
    137 min

    BDSR-496 Two Older Sisters' Dicks ●!! Simultaneous Tsundere Accusations Of An S Slutty Sister With Colossal Breasts And Big Breasts!! Strong Ejaculation With Double Blow Job & Double Hand Job!!

  • akari shinmura tomoka akari censoredcreampieslutBDSRbigmorkalyumejibig mocalBDSR-496BDSR49657bdsr00496
    • 2023-02-25
    167 min

    BHG-048 The Temptation Of A Big Breasts Slutty Older Sister Who Is So Sweet And Intensely Admired

  • suzuki mayu arioka miu censoredcreampieslutBHGgeinko pore shongain corporationBHG-048BHG048bhg00048
    • 2023-02-24
    140 min

    HMN-324 My Sleeping Sister-In-Law Mistook It For Cold Medicine And Gave Her Super Super Erectile Medicine ●, And Suddenly She Became A Slutty Girl! I Was Made To Get 10 Shots Creampied Until I Was Sweaty And Drunk, Lala Kudo

  • lara kudo censoredcreampieslutHMNhonnakatorendei yamaguchiHMN-324HMN324hmn00324
    • 2023-02-10
    120 min

    016HEZ-513 肉食系女性たちが集うクッソドエロい婚活シェアハウス シーズン2

  • amateur censoredcreampieamateurhezhez-513hez513016hez-513
    • 2023-02-17
    160 min

    HMN-315 W Female Anna Whispering Dirty Talk Harem: Two People Aiming To Be The Main Caster Compete For Me, The Program Producer, Reverse 3P Creampied Tsukino Luna Mori Hinako

  • tsukino luna hinako mori censoredcreampieslutHMNhonnakamamezawa mametarouHMN-315HMN315hmn00315



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download