slender def censored creampie jav




FC2AWDHUNTBHODVNATRMIAASHKDSDABEBODAUKSSPRDCAWDPPPDSANMILKAVSANACRSSNIBLKAPODMEYD

2024-05-05
245 min

MFCT-006 MOON FORCE 2nd Pokopo Kokushira Collection.vol.06

  • uzuki liana natsukawa akane censoredcreampiebig titsMFCTdocmoon force twiceMFCT-006MFCT006h-1711mfct00006
    • 2024-05-04
    126 min

    PKPD-298 A Simple Job That Just Creampie, A Boyfriend Who Got Tired Of A Family Restaurant Clerk Syntheous Pawn, Shinon 22 Years Old Nanase Shinon

  • nanase shino censoredcreampiePKPDpakopako team and pleasant friends delusion groupPKPD-298PKPD298pkpd00298
    • 2024-05-04
    119 min

    KSBJ-305 A Bride Summer Night, Dedicated To My Father -in -law At The Price Of Having My Husband A Secret Debt

  • natsuya eru censoredcreampiedramaKSBJksb planning emanuelrecobaKSBJ-305KSBJ305ksbj00305
    • 2024-05-04
    148 min

    PKPD-299 Amateur Saffleedocumement 23 Years Old G Cup Minato -ku Miss Mimi

  • censoredcreampieamateurPKPDpakopako team and pleasant friends delusion groupPKPD-299PKPD299pkpd00299
    • 2024-05-04
    139 min

    BAB-132 Prefectural Ordinary College Of Ordinary Course Luck Slender Beautiful Girl Mei CHAN 05

  • censoredcreampieBABbabylon mousouBAB-132BAB132bab00132
    • 2024-05-04
    123 min

    PKPR-026 Lover Ichu Love Document E Cup Slender Big Breasts Appearance JD Hikaru Miyanishi 1 Day Flirting

  • miyanishi hikaru censoredcreampiebeautiful girlPKPRpakopako team and pleasant friends delusion groupPKPR-026PKPR026pkpr00026
    • 2024-05-04
    118 min

    BABD-014 014, Shiraishi Momo, Who Has Sex Raw On A Once -in -a -month Dangerous Day

  • momo shiraishi censoredcreampieBABDdeep delusional familyBABD-014BABD014babd00014
    • 2024-05-03
    120 min

    NPJS-025 Tadaman Chance!Appropriate Age Sister Who Has Just Separated From Her Boyfriend Is Missing Human Skin, So If You Press A Little, You Will Be Excited!(NPJS-025)

  • censoredcreampieamateurNPJSnpjNPJS-025NPJS025npjs00025
    • 2024-05-03
    120 min

    WAAA-376 Sex Muscle Bakibaki Elegant Athlete With Full Power Standing Back Knee Gaku Tide Bubble Sagi Squid Sexual Fucking Lunar

  • tsuzuki ruisa censoredcreampiesquirtingWAAAones factorywanzWAAA-376WAAA376waaa00376
    • 2024-05-03
    120 min

    WAAA-371 Her Sister (plain, Shyness, No Sex Interest) Drowned In Kimezek And Cum Shot And Finished In A Creampie Meat Urinal.

  • itsukaichi mei censoredcreampiesquirtingWAAAones factorywanzWAAA-371WAAA371waaa00371
    • 2024-05-03
    140 min

    CAWD-648 [Emergency Taromi] New MLM Seems To Be Weak In Pushing A Repellent Program Returned A Multi Girls Who Seem To Be Weak SEX Yuhei

  • shitara yuhi censoredcreampiesquirtingCAWDkawaiitake dCAWD-648CAWD648cawd00648
    • 2024-05-03
    160 min

    LULU-296 If You Keep Playing With The Sensitive Big Nipple Of A Male Boyfriend"s Childhood Childhood, If You Keep Playing With It, Unexpected Leakage!I Was Unknowingly Erected, And I Was Crazy About The Incontinence Bichabicha ○ And Made A Bad Fe

  • mizutani nashi tomorrow censoredcreampieuniformLULUlunaticsnagases wingLULU-296LULU296lulu00296
    • 2024-05-03
    120 min

    MIAB-191 After School Every Friday, I Have Met My Friend, My Close Place And Time, And I"m Fucking Over And Over Again.A Classmate Who Has A Lover Of Each Other With A Classmate And After School

  • kanata t mi censoredcreampiebig titsMIABmoody strendy yamaguchieveryone s kikatanMIAB-191MIAB191miab00191
    • 2024-05-03
    120 min

    MIAB-188 A Longing Female Boss Who Decided To Leave The Company By Hitting Me And Decided To Leave The Company

  • miho tsuno censoredcreampieMIABmoody ssamuraieveryone s kikatanMIAB-188MIAB188miab00188
    • 2024-05-03
    180 min

    NPJS-034 After Taking Off, A Super Tight Athlete Body!The Next Day After Burning At The Last Retirement Tournament, I Was Picked Up And Wanted To Etch With Sex For Two Years, And I Won The Butchgiri Champion In The Endless Libido Fuck Michi -chan.

  • censoredcreampiesquirtingNPJSnpjNPJS-034NPJS034npjs00034
    • 2024-05-03
    150 min

    NPJS-026 I Met The Extra -thin Big Tits And Vaginal Cum Shot I Met By Drinking Dating Lounges, Gala Drinks, Daddy Life ... Even If Takamine Flowers That I Can"t Usually Hold, If I Have Overwhelming Money, I Can Make An Amateur A Lover.

  • censoredcreampiebig titsNPJSnpjtrendy yamaguchiNPJS-026NPJS026npjs00026
    • 2024-05-03
    150 min

    CLUB-840 Cheer Prestigious University Cheerleading Club Waisetsu Training Camp 1 Night 2 Days Orgy Party Voyeur Video

  • censoredcreampieCLUBhentai gentleman clubCLUB-840CLUB840club00840
    • 2024-04-27
    79 min

    CSPL-026 [4K] 4K Revolution Cos Is Cute, But It Doesn"t Stop.Nagisa Mitsuru

  • scooping censoredcreampieblowjobCSPLcrystal picturecosdeluxe plusCSPL-026CSPL026cspl00026
    • 2024-04-26
    74 min

    PKTA-024 P Live Interview Through!Dokata OK Every Time P Girl 24 Nagisa Chan

  • censoredcreampiePKTAp katsu oitanPKTA-024PKTA024h-1749pkta00024
    • 2024-04-20
    241 min

    KTRA-626 Continuous Vaginal Cum Shot To Garigarislender Beautiful Girls!!4 Hours

  • yume kotoishi kisaragi mashiro censoredcreampiebeautiful girlKTRAk tribeKTRA-626KTRA626ktra00626
    • 2024-04-10
    134 min

    XOX-011 Rookie Marina Nishini"s Active CA Flight Creampie AV Debut!!

  • nishi marina censoredcreampieXOXhmn worksgold rachanew starXOX-011XOX011h-1472xox00011
    • 2024-04-10
    81 min

    SDHS-048 Looks, Erotic, Personality, All S -class Luxury Mistress And Vaginal Cum Shot.Tin

  • censoredcreampieSDHSsod createtiger gavelSDHS-048SDHS0481sdhs00048
    • 2013-10-20
    84 min

    SBN-001 Beautiful Leg Masochistic Metamorphosis Lady

  • mizuki shiraishi mai tsukisaki censoredcreampiebukkakeSBNg historySBN-001SBN001h-759sbn00001
    • 2024-04-06
    142 min

    EKDV-741 The Destination Is A Country Town ... I Was Confused By The Slut Of A Beautiful Woman Who Lives Next To Me And I Was Vaginal Cum Shot Many Times ... Luna Tsukino

  • tsukino luna censoredcreampiesquirtingEKDVcrystal picturepearl rice sakagamie kissEKDV-741EKDV741ekdv00741
    • 2024-03-18
    62 min

    INSTV-547 [Individual Shooting] Loripeta Beautiful Girl Kone -chan (24) A Painful Lovable Love Love With Him, Who Will Go Far Away Next Week, The Last Asakusa Dating Raw Fucking Creampie Video Leaked

  • censoredcreampiebeautiful girlINSTVhmn worksinstaINSTV-547INSTV547h-1472instv00547
    • 2024-03-16
    123 min

    KSBJ-295 Classmate Madonna Was A Nasty Married Woman Who Seducted On The Day She Met Again.Tadokoro Yuri

  • yuri tadokoro censoredcreampiemature womanKSBJksb planning emanuelthin blade purpleKSBJ-295KSBJ295ksbj00295
    • 2024-03-16
    133 min

    TIKB-180 [Pakopako Douga] This Icharab Couple!It"s Too Erotic And It"s Impossible Www Nagisa Mitsuki

  • scooping censoredcreampiebeautiful girlTIKBchikikikikama delusion groupTIKB-180TIKB180tikb00180
    • 2024-03-16
    90 min

    BKD-328 Mother And Child Mating -Maya"s Waterfall -Natsuo Tono

  • tono natsuo censoredcreampiemature womanBKDrubyshakojijourneyBKD-328BKD328bkd00328
    • 2024-03-15
    150 min

    MEYD-894 Beautiful Leg Cabin Attendants And Overseas Hotels Who Have Decided To Leave The Company Are Alone At An Overseas Hotel ... A Passion Creampie Sexual Intercourse Of 12 Hours Until Returning Flight NTR Sumire Kurokawa

  • sumire kurokawa censoredcreampiemature womanMEYDtameike gorohide monkMEYD-894MEYD894meyd00894
    • 2024-03-15
    150 min

    MIAB-116 Vicious Pair Room NTR Esthetic, There Is A Boyfriend Right Next To It ... I Was Overwhelmed By A Guess Practitioner And I Repeated The Voice Of The Voice Over And Over Again ... Shiraishi Motomo

  • momo shiraishi censoredcreampiebeautiful girlMIABmoody sgoemoneveryone s kikatanMIAB-116MIAB116miab00116
    • 2024-03-15
    120 min

    MEYD-896 My Brother"s Wife After The Bath Is Too Thin And A Dust -like, Making It A Libido Monster!Runaway Pursuit NTR Sana Ueda Without Noticing That Shrimp Is Warped

  • ueda sana censoredcreampiemature womanMEYDtameike goroinugami ryoMEYD-896MEYD896meyd00896
    • 2024-03-15
    120 min

    MIFD-475 Welcome!Inverse Bunny Huge Breasts Soap Vaginal Cum Shot OK Continuous Fire OK Relatively Erotic Kos Fluffy Beautiful Breast Service & Satisfaction Agony Excitement Course Satomi Ishibashi

  • ishibashi satomi censoredcreampiebig titsMIFDmoody shiroharu osakimoodyz freshMIFD-475MIFD475mifd00475
    • 2024-03-15
    120 min

    PPPE-200 "I Don"t Have To Hesitate" My Boyfriend"s Dad (middle -aged Sports Manipulative) Sexual Harassment Pectoral Muscle Massage, And She Continues To Be Fucked While Being Blamed For Incontinence Nipple.

  • lima arai censoredcreampiebig titsPPPEoppaiPPPE-200PPPE200pppe00200
    • 2024-03-15
    156 min

    DVMM-081 「あなただけは特別に…」チ○ポにギリギリ触れない絶妙テク！焦らしの鼠径部マッサージで男を確実に悶絶させる長身スレンダー美女は結局三度の指名で生ハメできる 黒川すみれ

  • sumire kurokawa censoredcreampiehandjobDVMMdeepspoolsidedeep sDVMM-081DVMM081dvmm00081
    • 2024-03-15
    244 min

    MFCO-001 MOON FORCE WIFE Poco Kokushiro And A Married Woman Collection.vol.01

  • oikawa umi tsuzuki ruisa censoredcreampiebig titsMFCOdocmoon force okusamaMFCO-001MFCO001h-1711mfco00001
    • 2024-03-15
    120 min

    MIAB-138 The Paper Bread Is Likely To Be Cut Off Because It Erects Too Much ... A Tall Big Tits Body And Extreme Costumes Yuma Senu Esta Yuma Sano

  • sano yuma censoredcreampiebig titsMIABmoody scaptain gangwoneveryone s kikatanMIAB-138MIAB138miab00138
    • 2024-03-12
    58 min

    HONB-366 In The Mouth & Vagina 2 Launches In The 30kg Car Weak Girl Mina -chan

  • censoredcreampieHONBmercuryfirst shibuya special attack headquartersHONB-366HONB366h-1133honb00366
    • 2024-02-21
    144 min

    XOX-009 Office Lady By Day, Pole Dancer By Night, Beautiful Muscular Body, Newcomer Miina Yukisaki, 29 Years Old, Raw Creampie AV Debut

  • yukisaki miina censoredXOXhmn worksgold rachanew starXOX-009XOX009h-1472xox00009
    • 2024-02-17
    121 min

    NYKD-135 First Shot At 60th Birthday Chiharu Motomura

  • motomura chiharu censoredcreampiemature womanNYKDrubyyusuke murayamaprincessNYKD-135NYKD135nykd00135
    • 2024-02-23
    44 min

    AIDV-002 The World"s First AI Actress Ai Kihana Is Lifted!Initial Creampie Sexual Intercourse

  • kibana ai censoredcreampiebig titsAIDVh m pcrestfantasyAIDV-002AIDV0025642aidv00002
    • 2024-02-22
    145 min

    KANO-024 Creampie Room Drink Icharab Natural G Cup Musaka Yui Arisaka

  • arisaka yui censoredcreampiebeautiful girlKANOmonthly girlfriendKANO-024KANO0241kano00024
    • 2024-02-21
    133 min

    XOX-008 Tennis Club Current Female College Student Newcomer Akari Momota Is Fierce! Raw Creampie AV Debut!

  • momota akari censoredcreampiebeautiful girlXOXhmn workshakushunew starXOX-008XOX008h-1472xox00008
    • 2024-02-17
    120 min

    KSBJ-289 Ayako Inoue, A Beautiful Wife Who Was Forced To Physically Repay Her Husband"s Debts

  • ayako inoue censoredcreampiemature womanKSBJksb planning emanuelcherryKSBJ-289KSBJ289ksbj00289
    • 2024-02-17
    120 min

    AQSH-109 A Thin Mom Apologizes For Her Body. She Is Threatened And Humiliated By Her Classmate"s Father For Being A Delinquent Son! Ayano Kato

  • ayano kato censoredcreampiemature womanAQSHaquamall emanuelaqua mallAQSH-109AQSH109aqsh00109
    • 2024-02-16
    127 min

    MXGS-1321 No One Will Help Me, A Ruthless Creampie Rape Targeted By A Gay Guy Shiori Kuraki

  • kuraki bookmark censoredMXGSmaxingMXGS-1321MXGS1321h-068mxgs01321
    • 2024-02-16
    160 min

    MIAB-108 While Her Husband Was On A Business Trip, She Got Drunk And Picked Her Up In Reverse, And Even After The Last Train Had Passed, She Kept Having Creampie Sex With Him Over And Over Again. A Horny Housewife X Ladder Drinker, Kana Morisawa.

  • kana morisawa kanako iioka censoredcreampieMIABmoody sthere is alsoeveryone s kikatanMIAB-108MIAB108miab00108
    • 2024-02-16
    240 min

    MKCK-352 Creampie Intercourse 84 Times, With A Young Face And Big Breasts, Injecting A Lot Of Thick Sperm Into The Immature Body Of A Girl In Uniform

  • amatsuki azu yuria hafu censoredcreampiebig titsMKCKe bodyMKCK-352MKCK352mkck00352
    • 2024-02-16
    120 min

    PPPE-204 Spence Breast Development Clinic Mary Tachibana

  • tachibana mary censoredcreampiebig titsPPPEoppaiPPPE-204PPPE204pppe00204
    • 2024-02-16
    150 min

    PRED-546 I"ve Always Wanted To Fuck You. Amateur Reunion Covered In Aphrodisiac Ayaka Yamagishi As Revenge For Being Dumped 15 Years Ago

  • yamagishi ayaka yamagishi aika censoredcreampiePREDpremiumcomet akaielegancePRED-546PRED546pred00546
    • 2024-02-16
    120 min

    KAM-173 “Someone...someone Please Help Me...” A Voiceless Scream! I Can"t Even Moan And Suppress My Voice... Beautiful Girl In A Sensitive Uniform Gets Creampied Inside The Library 3 Rei Misumi

  • misumi rei censoredcreampiebeautiful girlKAMkarmagroupKAM-173KAM173kam00173
    • 2024-02-16
    120 min

    PRED-557 Creampie Ban Lifted For The First Time In My Life! Premium Exclusive Decided S-class Slender Body Suddenly 10 Creampies Special Ichika Hoshimiya

  • ichika hoshimiya censoredcreampiePREDpremiumtrendy yamaguchielegancePRED-557PRED557pred00557
    • 2024-02-16
    120 min

    MIMK-147 How To Destroy A Black-hearted Woman ~The Case Of Kuriko Hirai, The Student Council President~ Live-action Version A Thorough Rape Of The Worst Scumbag Woman! Rape! ! Rape! ! !

  • hikaru minazuki yura kana censoredcreampieschoolgirlMIMKmoody ssugawaramankitsuMIMK-147MIMK147mimk00147
    • 2024-02-15
    113 min

    HMRK-001 [Golden Ratio Erotic Body Healing Beauty] Although She Is Neat, She Likes Perverted Play! The Smile, The Blowjob Face, And The Orgasm Face Are All Cool! A Naughty And Beautiful College Girl With Beautiful Breasts And A Lovey-dovey Sex Video

  • miyanishi hikaru censoredcreampiebig titsHMRKdochameroku channelHMRK-001HMRK001h-1711hmrk00001
    • 2024-02-15
    83 min

    KAMEF-069 Specializing In Individual Photography Big Breasted Idol Photo Session Ai-chan (19) Machida Lens"s BLACK KAMEKO FILE.69 An Idol Who Knows Nothing Participates In An Obscene Photo Session Like A Part-time Job. Her Breasts Are Photographe

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-069KAMEF069h-1350kamef00069
    • 2024-02-15
    92 min

    UINAV-002 [Bakki Baki Erotic Body] Mechashi Cosplay Slender Beautiful Breasts Muscle Training Girl Tipsy Muscle Protein Creampie On Cheat Day! ! [Chest Constriction Butt]

  • censoredcreampieUINAVhmn workshamedori.network secondeditionUINAV-002UINAV002h-1472uinav00002
    • 2024-02-08
    75 min

    KAMEF-068 Cosplay Photo Session Specializing In Individual Photography Sally (27) Machida Lens"s BLACK KAMEKO FILE.68 The Most Beautiful Office Lady Layer Is Creampied And Turned Into A Meat Urinal. She Is Raped With A Raw Dick And Her Plump Areo

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-068KAMEF068h-1350kamef00068
    • 2024-01-30
    64 min

    EROFV-237 Amateur JD [Limited] Shion-chan, 21 Years Old, Is A Popular JD Who Sells Her Looks To Rival Idols! ! Creampie SEX With A JD Who Loves Men Who Is Having Fun Even Though It Would Be Out If The Fans Found Out! !

  • censoredcreampieamateurEROFVhmn workslove girlfriendEROFV-237EROFV237h-1472erofv00237
    • 2024-01-28
    108 min

    HMDNV-690 [Running Sexual Desire] A 24-year-old Slender And Happy Young Wife Brings Her Sex Friend With Her While Her Husband Is Away And Makes Her Do It! ! A Machine Gun Piston That Won"t Stop Even If You Cum Or Blow, It Will Break The Unconscio

  • censoredcreampiemature womanHMDNVhmn workshamedori.network secondeditionHMDNV-690HMDNV690h-1472hmdnv00690
    • 2024-01-26
    26 min

    NJPD-010 Mitsuki Nagisa

  • scooping censoredcreampiebeautiful girlNJPDnew japan av actress directorynew japan av actress directoryNJPD-010NJPD010h-1754njpd00010
    • 2024-01-26
    242 min

    MFCD-002 MOON FORCE Pakopakoshiroto Collection. Vol.02

  • minase akari morishita kotono censoredcreampiebig titsMFCDdocmoon force dreamMFCD-002MFCD002h-1711mfcd00002



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download