schoolgirl beautiful girl javcensored censored high vision




FC2SHKDDTTGVHMEYDMILKSTARSFSDSSPPPDAPODHZGDAVSANNPJMIDEAUKGWAAAGMEMKBIHODVDASDNACX

2019-10-12
146 min

[MVSD-405]Beautiful Girl Raw Backside Part-Time Job! She Asks To Get Her Ass Licked Out, The Anal Makes Her Feel So Sensitive! 19 Year Old Busty Girl Rui Himegari

  • scolding censoredanalcreampieMVSDm s video groupMVSD-405MVSD405mvsd00405
    • 2019-10-12
    166 min

    [MVSD-406]Beautiful Young Girls In Uniform Work Part Time Swallowing Cum - Threesome Heaven - A Full Body Licking, Cum Swallowing Service For Middle-Aged Men Only - Mari Kagami, Nazuna Nonohara

  • mari kaga nazuno nonohara censoredschoolgirlbeautiful girlMVSDm s video groupkirinMVSD-406MVSD406mvsd00406
    • 2019-10-11
    129 min

    [GGEN-001]I Found A Stopwatch That Makes People Move 1/10th Their Normal Speed, So I Tried It On A Beautiful Girl Who Hates Me...

  • censoredschoolgirlbeautiful girlGGENprestigeless than 3dGGEN-001GGEN001118ggen00001
    • 2019-10-11
    123 min

    [GZAP-001]We Made A Cute, Studious Girl Drink Diuretics And Piss Her Pants! Then We Talked Her Into Some Shameful Pussy-Licking And Creampie Sex!

  • censoredcreampieschoolgirlGZAPprestigesapGZAP-001GZAP001118gzap00001
    • 2019-10-10
    70 min

    [GEKI-049]A Pussy-Juice Squirting Angel Who Will Get Her Pussy Dripping Wet From Just A Kiss! When Her Soaking Wet Pussy Starts Dribbling Pussy Juices Everywhere, She'll Get A Big Grownup Cock Shoved Inside As She Gets Massive Cum Facial Orgasmic

  • scooping censoredschoolgirlbeautiful girlGEKIsuper rare amateurog leakinGEKI-049GEKI049geki00049
    • 2019-10-10
    93 min

    [OKB-073]A Voluptuous Big Ass A Goddess In Bloomers Mio Ichijo From A Lolita Beautiful Girl, To A Married Woman (Dear Wife, Can I Fuck You？), And A Chubby Girl, We Dressed These Hot Bitches In Tight Bloomers And Gym Shorts So We Could See Their Asses

  • ichijo mio censoredcreampieschoolgirlOKBdaddy s private photosgoddess in bloomersOKB-073OKB0731okb00073
    • 2019-10-06
    149 min

    [MIAA-167]This Young Girl Keeps On Sucking Even After I Cum In Her Face, So I Go Ahead And Cum Some More - Akari Neo

  • akari neo censoredschoolgirlblowjobMIAAmoody scomet akaieveryone s kikatanMIAA-167MIAA167miaa00167
    • 2019-09-28
    122 min

    [DLIS-016]中年オヤジに性開発された黒髪制服少女 南梨央奈

  • rina minami censoredcreampieschoolgirlDLISsharkred beedelicious timeDLIS-016DLIS016h-687dlis00016
    • 2019-09-28
    120 min

    [MIAA-159]I Was Stranded With My Girlfriend's Little Sister By A Sudden Rainstorm, And So We Had To Stick It Out Until Morning... Akari Neo

  • akari neo censoredschoolgirlbeautiful girlMIAAmoodyzryo inugamieveryone s porn starMIAA-159MIAA159miaa00159
    • 2019-09-27
    150 min

    [SABA-558]Super Cure Girl Throat Fuck Body Fluids Creampie

  • censoredcreampieschoolgirlSABAskyu shirototoranosukeSABA-558SABA558h-244saba00558
    • 2019-09-27
    128 min

    [HKD-008]Those Were The Days, With That Beautiful Young Girl In Uniform Rion Izumi

  • rion izumi censoredschoolgirlblowjobHKDdream ticketHKD-008HKD00824hkd00008
    • 2019-09-27
    150 min

    [WPOM-004]"You Can Take Footage, But Can I Concentrate On The Sex？" Active Girl Worried By A Very Private Video That Was Supposed To Be Sold Before Her Graaduation If She Wasn't In School At The Time

  • koharu tsuji erika rin sakuragi censoredschoolgirlblowjobWPOMwaap entertainmentsWPOM-004WPOM0042wpom00004
    • 2019-09-26
    93 min

    [OKB-072]A Voluptuous Big Ass A Goddess In Bloomers Yui Tomita We Dressed A Lolita Beautiful Girl And A Chubby Girl In Tight Bloomers And Gym Shorts So We Could See Their Asses And Cameltoes Bulging Out So Hard Their Pussy Hairs Were Poking Out For S

  • yu tomita censoredcreampieschoolgirlOKBdaddy s private photosgoddess in bloomersOKB-072OKB0721okb00072
    • 2019-09-26
    48 min

    [AKDL-001]A 148cm Tall Beautiful Girl x A 100kg Massively Endowed Orc A Six-Way Hard-Press Impregnation Orgy Fuck Fest Hikaru Minazuki

  • hikaru minazuki censoredcreampieschoolgirlAKDLakinori10 000 tons of sugaraknrAKDL-001AKDL0011akdl00001
    • 2019-09-22
    185 min

    [ROOM-001]"The Truth Is, Girls Are Really Horny Too!" This Young Lady In Her School Uniform Is Cumming Over And Over After School Because She's A Perverted J* Who Loves Creampie Sex

  • scooping misaka ria censoredcreampieschoolgirlROOMhomeroom daydream tribehomeroom homeroom daydream tribeROOM-001ROOM001room00001
    • 2019-09-22
    125 min

    [DARU-001]Time Stop Girls' School Infiltration

  • censoredschoolgirlbeautiful girlDARUdarumax daydream tribeDARU-001DARU001daru00001
    • 2019-09-22
    182 min

    [ROOM-002]"All I Can Say Is That No One Knows... But I Love To Have Sex. LOL" This Perverted J* Is A Young Lady In A School Uniform Who Enjoys Having Creampie Sex After School

  • inaba kanae lennon censoredcreampieschoolgirlROOMhomeroom daydream tribehomeroom homeroom daydream tribeROOM-002ROOM002room00002
    • 2019-09-22
    181 min

    [ROOM-003]"I Could Never Ask This Out Loud... But When I Cum, Is It Okay To Say 'I'm Cumming!'？" LOL This Young Lady In Her School Uniform Is A Perverted J* Who Enjoys Cumming Over And Over Again In After School Creampie Sex

  • miho yui azumihina nagai mihina censoredcreampieschoolgirlROOMhomeroom daydream tribehomeroom homeroom daydream tribeROOM-003ROOM003room00003
    • 2019-09-21
    240 min

    [POKA-006]Mari Hirose A Mountain Girl Too Bad It's Raining! We're Camping Indoors, But Having A Lovey Dovey Sexy Good Time

  • mari hirose censoredcreampieschoolgirlPOKAwarm daydream groupwarmthPOKA-006POKA006poka00006
    • 2019-09-21
    240 min

    [POKA-008]Lulu Arisu My Cute Little Friend Came Up To Tokyo And Said She Wanted To Become My Wife. But When She Went Back Home...

  • have censoredcreampieschoolgirlPOKAwarm daydream groupwarmthPOKA-008POKA008poka00008
    • 2019-09-20
    241 min

    [DOCP-172]"I Already Came..." My Little Sister Teased Me About Me Still Being A Cherry BoyBy Flashing Her Panties At Me So I Fucked Her Wildly And Made Her Orgasm Over And Over Again! vol. 2

  • yui nagase natsuho imai censoredschoolgirlbeautiful girlDOCPprestigedoc premiumDOCP-172DOCP172118docp00172
    • 2019-09-13
    128 min

    [GIRO-059]This Gal Thwarted An Underwear Thief, And Now She Was Overflowing With A Prideful Feeling Of Justice, But Now She Was Surrounded By Criminals Who Didn't Like Being Caught, And Then She Got Fucked Until She Crumbled Into A Heap Of Tears.

  • censoredschoolgirlbeautiful girlGIROprestigeogleGIRO-059GIRO059118giro00059
    • 2019-09-13
    208 min

    [BAZX-206]A Modern Cute Gal Schoolgirl vol. 008

  • censoredcreampieamateurBAZXmedia stationtodobazookaBAZX-206BAZX20661bazx00206
    • 2019-09-13
    240 min

    [MMB-265]A Beautiful Girl With A Godly Ass In Bloomers BEST HITS COLLECTION An Afternoon Sex Journal Entry With A Voluptuous Pretty Ass

  • censoredschoolgirlMMBmomotaro eizohakase ishikiribashimomotaro s bestMMB-265MMB265mmb00265
    • 2019-09-13
    236 min

    [RIX-069]Private Room Schoolgirl Sexual Massage Peeping 3

  • censoredamateurbeautiful girlRIXprestigerelaxation roomRIX-069RIX069118rix00069
    • 2019-09-12
    144 min

    [FONE-082]The Student Council President Is A Big Tits Little Devil Slut No More Bad Teacher x A Massive Schoolwide Cleanup...

  • censoredcreampiebig titsFONEfirst starplus first starFONE-082FONE082h-491fone00082
    • 2019-09-12
    129 min

    [FSKI-013]The House Across The Way Is A Girls' Dormitory! This Female Student Had No Idea That A Man Was Peeping On Her While She Changed, And All The Other Embarrassing Details Of Her Daily Life One Day, Their Eyes Met... And He Realized, "I

  • censoredcreampieschoolgirlFSKIfirst starultimate planFSKI-013FSKI013h-491fski00013
    • 2019-09-10
    304 min

    [EQ-474]Taste-Testing Two Friendly Sisters! "Hey, If My Big Sister Finds Out, We're In Big Trouble!" When I Fucked My Girlfriend's Little Sister, I Got Caught, And Decided To Fuck Them Both!

  • censoredbig titsschoolgirlEQbullittkazuki enitazuraEQ-474EQ474h-100eq00474
    • 2019-09-09
    116 min

    [AVSA-099]The Gorgeous Face Of The Girl I've Yearned For: Innocent Ponytail Uniform Girl Immoral No Pulling Out - Mitsuki Nagisa

  • scooping censoredschoolgirlbeautiful girlAVSAavs collector shiroyuki kimuraavscollector sAVSA-099AVSA099avsa00099
    • 2019-09-08
    150 min

    [MIDE-681]She's Luring You With Her Panties Off From The Other Side Of That Mirror A Beautiful Girl At A Reflexology Parlor Who Wants To Service You With Secret Options (Like Sex) Mia Nanasawa

  • nanasawa mia censoredschoolgirlbeautiful girlMIDEmoodyzhirokoji osakimoodyz divaMIDE-681MIDE681mide00681
    • 2019-09-08
    151 min

    [IPX-368]A Budding Total Domain Alluring Temptation A Little Devil Beautiful Young Girl In Uniform And Knee-High Socks Kana Momonogi

  • kana momonogi censoredschoolgirlbeautiful girlIPXidea pocketkirindishIPX-368IPX368ipx00368
    • 2019-09-01
    241 min

    [BUR-532]Wide Open Pussies Dildo Masturbation With Young Hotties Only 4 Hours

  • censoredschoolgirlbeautiful girlBURglay zburst graceBUR-532BUR53212bur00532
    • 2019-09-01
    121 min

    [AMBI-105]Physical Relationship With Middle-aged Man Continues After Graduation Momo Kato

  • kato momoka censoredcreampieschoolgirlAMBIplanet plusbirdman teppeianbibaresotsuAMBI-105AMBI105h-237ambi00105
    • 2019-08-31
    160 min

    [JUFE-091]Stolen By A Black Man - My Wonderful Girlfriend Gets Taken Away From Me By A Vulgar Foreign Exchange Student... Mitsuki Nagisa

  • scooping censoredcreampieschoolgirlJUFEfitchJUFE-091JUFE091jufe00091
    • 2019-08-24
    118 min

    [HND-716]My Adolescent Cousin Is Deeply Interested In Sex, And So, For 3 Days While My Parents Were Away, We Made Some Memory-Making Creampie Sex To The Limits Of Endurance. Yui Nagase

  • yui nagase censoredcreampieschoolgirlHNDhon nakatiger kosakaiHND-716HND716hnd00716
    • 2019-08-23
    128 min

    [HKD-007]At That Time, I Did It With A Beautiful Young Girl in Uniform. Hatori Mizuki

  • mitsuki hatori censoredschoolgirlblowjobHKDdream ticketHKD-007HKD00724hkd00007
    • 2019-08-23
    123 min

    [DFE-033]Personal Sentence Yua Takanashi

  • yuu takanashi censoredschoolgirlbeautiful girlDFEwaap entertainmentikkyu senfearlessDFE-033DFE0332dfe00033
    • 2019-08-22
    93 min

    [OKB-070]Big Chubby Ass - Godly Panties - Miu Sanae - A Beautiful Chubby Young Girl Puts On Panties And Gym Clothes And Shows Off Her Ass And Pussy In Shots So Close You Can See Her Pores! She Performs An Assjob, Pees Her Pants, Gets Bukkake'd An

  • miwa censoredcreampieschoolgirlOKBdaddy s private photosgoddess in bloomersOKB-070OKB0701okb00070
    • 2019-08-21
    240 min

    [POKA-005]Sena Kusunoki A Live Chat Job In Uniform... She's Having Offline Sex While She Waits For A Chat With Her Manager

  • sena censoredcreampieschoolgirlPOKAwarm daydream groupwarmthPOKA-005POKA005poka00005
    • 2019-08-21
    240 min

    [POKA-004]Rio Megumi A Maso Beautiful Girl In Uniform Gets Her Mind Dominated And Her Body Freed She Drowns In The Pleasures Of Her Insatiable Lust...

  • grace censoredcreampieschoolgirlPOKAwarm daydream groupwarmthPOKA-004POKA004poka00004
    • 2019-08-16
    157 min

    [MVSD-396]A Beautiful Young Girl In Uniform Is Working A Cum Swallowing Part-Time Job A Delivery Health Full-Body Lip Service Cum Sucking Reflexology Salon For Middle-Aged Men Only Nanaho Kase

  • nanaho kase censoredschoolgirlbeautiful girlMVSDm s video groupkirinMVSD-396MVSD396mvsd00396
    • 2019-08-16
    119 min

    [SSNI-546]She Was One Grade Above Him, And He Always Admired This Madonna From Afar, But Now, On This Club Field Trip, They Were Sharing The Same Room, For The 3 Days Straight. Arina Hashimoto

  • there is hashimoto censoredschoolgirlbeautiful girlSSNIs1 no 1 stylejo styleSSNI-546SSNI546ssni00546
    • 2019-08-12
    209 min

    [FSKI-010]"I Can't Say No..." They Thought They Were Safe With A Female Masseuse At A Massage Parlor, But She's Suddenly Switched To A Male Masseur？! Beautiful Young Girls In Uniform Are Sweet-Talked Into Letting The Man Give Them An

  • censoredsquirtingschoolgirlFSKIfirst starultimate planFSKI-010FSKI010h-491fski00010
    • 2019-08-10
    119 min

    [MIAA-135]Beautiful Young Girl In Uniform Reflexology Backdoor Service Legalized Mitsuki Nagisa

  • scooping censoredschoolgirlhandjobMIAAmoodyzdragon nishikawaeveryone s porn starMIAA-135MIAA135miaa00135
    • 2019-08-09
    210 min

    [MDTM-553]This Sch**lgirl Was Hunting For Sugar Daddies, But Then She Went On An Impregnation Fuck Fest 01

  • ai rui akari hoshimiya censoredcreampieschoolgirlMDTMmedia stationsuginokiuchu kikakuMDTM-553MDTM55361mdtm00553
    • 2019-08-09
    146 min

    [MDTM-552]My Very Own Schoolgirl Idol Who Lets Me Give Her A Creampie Whenever I Want. Mei Kotone

  • kotone mei censoredcreampieschoolgirlMDTMmedia stationsuginokiuchu kikakuMDTM-552MDTM55261mdtm00552
    • 2019-08-09
    132 min

    [GETS-125]We Got Our Hands On Some Amateur Boys And Girls For An Experimental Survey!! A Beautiful Girl In A School Swimsuit x A Normal Old Man With A Huge Cock "Your Daddy Friend Is Always Helping You Out, So Now It's Your Turn To Return The

  • censoredschoolgirlamateurGETSprestigescoreGETS-125GETS125118gets00125
    • 2019-08-08
    93 min

    [OKB-069]A Chubby Ass In Godly Panties - Hikaru Konno - A Young Girl Puts On Gym Clothes To Show Off Her Curves In Close-Up Shots That Reveal Every Detail! Enjoy A Full Course Of Ass Jobs, Golden Showers, Bukkake And Creampies In The Perfect Presenta

  • hikaru konno censoredcreampieschoolgirlOKBdaddy s private photosgoddess in bloomersOKB-069OKB0691okb00069
    • 2019-08-06
    119 min

    [STARS-105]A Young Girl In A Summer Outfit Gets Molested On The Train, And Seems To Be Enjoying It - Mahiro Tadai

  • mahiro yui censoredschoolgirlbeautiful girlSTARSsod createbieber gonzosod starSTARS-105STARS1051stars00105
    • 2019-08-01
    485 min

    [NHDTB-301]Natural High 20th Anniversary The Molester Rally 2019 Exclusive Footage From This Summer 10 Videos Complete (Creampie) Special

  • censoredcreampiebig titsNHDTBnatural highitaka smith rimpounderNHDTB-301NHDTB3011nhdtb00301
    • 2019-08-01
    180 min

    [SS-143]Amateur Sailor Cosplay Creampie - Sora Kamikawa - An Innocent Young Girl With Light Skin And Sensitive A-Cup Tits Lets You Creampie Her And Indulge Your Pregnancy Fetish

  • kamikawa starry sky censoredcreampieschoolgirlSSplumshirouto only plumSS-143SS143h-113ss00143
    • 2019-08-01
    136 min

    [AMBI-103]A Beautiful Girl With Black Hair In Twin Ponytails Orgasms Hard And Fast - Hana

  • hirahana censoredcreampieschoolgirlAMBIplanet plusbirdman teppeianbibaresotsuAMBI-103AMBI103h-237ambi00103
    • 2019-08-01
    240 min

    [MIX-029]Ai Hoshina 4 Hours

  • sena ai censoredcreampieschoolgirlMIXglay zmix glay zMIX-029MIX02912mix00029
    • 2019-07-26
    123 min

    [HKD-006]I Remember Those Days, When I Was With A Beautiful Young Girl In Uniform Suzu Arima

  • arima tin censoredschoolgirlblowjobHKDdream ticketHKD-006HKD00624hkd00006
    • 2019-07-26
    264 min

    [OKAX-536]Teacher, I Want Your Big Dick Inside Me

  • ai mukai misa kurusu censoredcreampieschoolgirlOKAXk m produceokazuOKAX-536OKAX53684okax00536
    • 2019-07-14
    150 min

    [CMC-221]Uniform Immoral Beautiful Girl's Period Of Perverted Lust Maina Miura

  • mai minamata censoredschoolgirlsingle workCMCcinemagicshinichi kawamuracollectCMC-221CMC221cmc00221
    • 2019-07-12
    301 min

    [VRTM-443]V&R 2018 Firs Half Highlights

  • censoredcreampiebig titsVRTMv r produceVRTM-443VRTM443h-910vrtm00443
    • 2019-07-12
    128 min

    [MDTM-544]My Very Own Sch**lgirl Idol Who Will Let Me Creampie Fuck Her Anytime I Want Mitsuki Nagisa

  • scooping censoredcreampieschoolgirlMDTMmedia stationsuginokiuchu kikakuMDTM-544MDTM54461mdtm00544
    • 2019-07-12
    225 min

    [SCPX-364]I'm A Cherry Boy, And My Childhood Friend Is A Virgin, And We're Bashfully About To Practice Having Sex! I Promised Only To Rub My Cock Against Her Clit, But Then Her Pussy Got Dripping Wet, And My Dick Just Slipped Right In! As Soo

  • censoredcreampieschoolgirlSCPXscoopyosukemousouzokuSCPX-364SCPX364h-565scpx00364
    • 2019-07-12
    110 min

    [VRTM-441]Mixing Together Aphrodisiacs And Date Rape Drugs! This Girl With A Big Ass Was Put To Sleep While Wearing Her School Swimsuit And Tied Up And Toyed With Relentlessly! When Her Body Awakened To Her Sexual Desires, Her Dad Relentlessly Pussy

  • arisaka miyuki hikaru minazuki censoredschoolgirlbeautiful girlVRTMv r produceyamanaka socksVRTM-441VRTM441h-910vrtm00441



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download