sama




FC2HNDIPXMIDVDTTVENUNACXWAAAAUKSHDKASTARSSQTESHKDMEYDCESDSPRDNGODMIDEVEMARBDJUFE

2011-08-27
63 min

[082711-791]If My GF Was Tsubasa Miyashita...

  • amateur uncensoredcreampiecaribbeancom
    • 2012-04-19
    52 min

    [041912-998]Super Pornstar having real orgasm

  • kotone amamiya uncensoredcreampiecaribbeancom
    • 2012-09-28
    156 min

    [MIGD-472]A Woman gets a three-hole treatment, A Creampie Gang Bang Mari Ariyasu

  • mari ariasu censoredanalcreampieMIGDmoodyzdragon nishikawamoodyz gatiMIGD-472MIGD472migd00472
    • 2012-10-07
    118 min

    [MIDD-914]Yuria Satomi Pops A Boys Cherry!

  • satomi yuria censoredcosplayslutMIDDmoodyzrakudamoodyz divaMIDD-914MIDD914midd00914
    • 2013-07-04
    103 min

    [ATID-226]Schoolgirl Investigator Sakura - Cram School with Disappearing Students Sakura Aida

  • aida sakura censoredschoolgirlsingle workATIDattackersmosaku niizatoin madATID-226ATID226atid00226
    • 2014-01-19
    128 min

    [IENE-359]This Cherry Boy Can't Take It Anymore! I Put An Aphrodisiac In My Sister's Body Lotion And Now She Wants Me...

  • censoredcreampiesisterIENEienergytiger kosakaiie nergyIENE-359IENE3591iene00359
    • 2014-06-28
    156 min

    [MIDE-127]Super Exquisite Soapland Lady With D Cup Tits (Yu Konishi)

  • atsushi konishi censoredbig titssingle workMIDEmoodyzk c takedamoodyz divaMIDE-127MIDE127mide00127
    • 2014-08-02
    120 min

    [RBD-608]Outside Nude Torture. The Naughty Stuff I Saw. Yukiko Suou and Nao Mizuki .

  • yukiko suou nao mizuki censorednurseRBDattackersryo inugamiryupakuRBD-608RBD608rbd00608
    • 2014-10-23
    130 min

    [SW-289]"Dad, You Really Are Young And Healthy Down Here, Aren't You？" I Got A Boner While Being Nursed By My Son's Wife. As Soon As She Noticed It, She Carefully Sat Her Pussy On My Hard Penis!

  • censoredSWswitchyocchanswitch switchSW-289SW2891sw00289
    • 2015-11-18
    63 min

    [FC2-PPV 356824]【個人撮影】ゆうき１８才 絶叫娘☆選抜合宿前にクリで痙攣噴射！スポーツ娘に大量中出し【素人動画】

  • amateur uncensoredfc2
    • 2015-11-27
    117 min

    [ESK-272]Escalation Chick 272

  • censoredamateurESKprestigeupdatingESK-272ESK272118esk00272
    • 2016-02-14
    118 min

    [SNIS-610]Mixed Body Fluids, Deep Sex Non Suzumiya

  • suzumiya censoredbeautiful girlsingle workSNISs1 no 1 stylehao minamiSNIS-610SNIS610snis00610
    • 2016-02-19
    131 min

    [ABP-444]Orgasmic Lingerina 12 Arisa Misato

  • misato arisa censoredbig titslingerieABPprestigekata hiroshiABP-444ABP444118abp00444
    • 2016-02-27
    119 min

    [WANZ-466]Schoolgirl Creampie Soapland Harula Mori

  • forest harura censoredcreampieschoolgirlWANZwanz factorywanzWANZ-466WANZ466wanz00466
    • 2016-05-28
    98 min

    [KBKD-1500]My Girlfriend's Mom Ayano Kamiyama

  • ayano kamiyama censoredmature womanmomKBKDkobayashi kogyokobayashiKBKD-1500KBKD1500h-046kbkd01500
    • 2016-06-04
    147 min

    [SNIS-666]Completely Stuck Kirara Asuka Gets Fucked So Hard She Cums Over And Over Again!

  • asuka kirara censoredbig titssingle workSNISs1 no 1 stylejo styleSNIS-666SNIS666snis00666
    • 2016-08-27
    119 min

    [MIAD-945]Beautiful Girl x Squirting! Pissing Herself With Pleasure. Miyuki Sakura

  • sakura miyuki censoredschoolgirlbeautiful girlMIADmoodyzkyoseimoodyz acidMIAD-945MIAD945miad00945
    • 2017-04-23
    103 min

    [BIJN-114]I'm Gonna Creampie And Pregnancy Fetish Fuck This Horny Bitch With Massive Loads Of Semen! Yu Kawakami

  • yu kawakami morino morino censoredmature womansingle workBIJNbijin majoBIJN-114BIJN114bijn00114
    • 2017-05-11
    119 min

    [MIAE-057]Total Domain A Schoolgirl In Beloved Knee High Socks Yuka Hodaka

  • yuka hotaka censoredschoolgirlbeautiful girlMIAEmoodyzMIAE-057MIAE057miae00057
    • 2017-06-01
    135 min

    [SDMU-603]SOD Female Employees Our New Office Uniforms Show More Than 5cm of Lower Titties, And Over 5cm Of Ass We Call It The 5cm Cool Business Attire! But Unfortunately, Our Business Partners Got Overly Excited, And...

  • censoreduniformSDMUsod createk westsod female employeeSDMU-603SDMU6031sdmu00603
    • 2017-09-25
    240 min

    [JKSR-305]Country Amateur Girls So Beautiful You Just Have To Sigh, And Now They're Bashfully Letting Us Creampie Them... 4 Hours vol. 3

  • censoredcreampieamateurJKSRbig morkalobockeyprink junkyJKSR-305JKSR30557jksr00305
    • 2017-10-06
    238 min

    [FIV-001]A Five Star Glamorous Married Woman Special 01 All These Ladies Have Big Tits And The Strongest And Small Waist Bodies! Deep And Rich Sex That Only Mature Ladies Can Provide!

  • censoredbig titsdeepthroatFIVprestigeupdatingFIV-001FIV001118fiv00001
    • 2017-10-15
    241 min

    [GDTM-206]Highly Concentrated 4 Hours! Defile Them, Bukkake Them, And Hit Them With Sprays Of Cum Face Semen In This Fuck Fest Appreciation Day A Cum Face Loving Label Is Giving Us The Best Selection Of Cum Face Ecstasy

  • censoredamateurGDTMgolden timedont knowhhh groupGDTM-206GDTM206gdtm00206
    • 2017-10-27
    58 min

    [230ORETD-122]マイちゃん (21才)

  • amateur censoredcreampieamateuroretdoretd-122oretd122230oretd-122
    • 2017-11-16
    131 min

    [KMHR-017]Alice Toyonaka AV DEBUT I Get Excited Just Thinking That All These People Will Be Watching Me

  • alice toyonaka censoredsingle workKMHRsod createmanbo nishinakajimai fell in love with youKMHR-017KMHR0171kmhr00017
    • 2017-11-23
    120 min

    [DSAM-119]Perverted Hot Spring : Haruka Aizawa

  • haruka aizawa uncensored
    • 2018-02-02
    120 min

    [ONEZ-122]#Tokyo Raw Creampie Pussy Pounding Gal In Uniform Vol.002 Shino Saijo

  • saijo censoredcreampiebig titsONEZprestigeonezONEZ-122ONEZ122118onez00122
    • 2018-02-03
    121 min

    [IPX-087]Targeted College Girl Molestation Bus Conspicary Tsumugi Akari

  • akari tsumugi censoredsingle workIPXidea pockethiromichi miyasedishIPX-087IPX087ipx00087
    • 2018-04-13
    247 min

    [UMSO-181]6 Obedient Amateur Girls Who Fell For Clever Fast-Talking Adults

  • censoredcreampiebig titsUMSOkm produceumanamiUMSO-181UMSO18184umso00181
    • 2018-04-14
    153 min

    [SSNI-186]Ecstatic G-Spot Evolution Big Cock x Deep Pussy Orgasm Yura Kano

  • yura kanno censoredsquirtingbeautiful girlSSNIs one number one stylexs1 no 1 styleSSNI-186SSNI186ssni00186
    • 2018-04-21
    153 min

    [PLA-068]Tiny Titties And A Macho Cock "Wriggling And Writhing Hard Piston Fucking" Yukari Mitsuya

  • yukari mitsuya censoredbeautiful girlPLAdassmohicalplatinaPLA-068PLA068pla00068
    • 2018-05-03
    94 min

    [YMDD-122]The Hottest Beautiful Girl In Town! A Camera Girl With Colossal Tits Sakura Kirishima

  • kirishima sakura censoredcreampiebig titsYMDDmomotaro eizoasakusa ga jirowakamomoYMDD-122YMDD122ymdd00122
    • 2018-09-22
    63 min

    [092218_01]Yayoi Uemoto

  • yayoi uemoto uncensored10musume
    • 2018-11-17
    119 min

    [SSNI-350]Hanon Hinana Is Completely Restrained And Unable To Move. Endless Fucking That Doesn't Stop No Matter How Many Times She Orgasms

  • hinana is no censoredsquirtingSSNIs one number one stylesugawaras1 no 1 styleSSNI-350SSNI350ssni00350
    • 2019-01-11
    120 min

    [RED-107]Red Hot Fetish Collection Vol.89 : Yuuka Tusbasa

  • yuuka tusbasa uncensoredcreampiebukkaketokyo hot
    • 2019-01-25
    78 min

    259LUXU-1058 Luxury TV 1056

  • amateur censoredmarried womanamateurluxuluxu-1058luxu1058259luxu-1058
    • 2019-02-16
    132 min

    [SSNI-409]The Female Undercover Investigator. Aphrodisiac And Brutal Torture Special. Yua Mikami

  • yua mikami censoredbig titssingle workSSNIs1 no 1 styleichigoharaSSNI-409SSNI409ssni00409
    • 2019-02-22
    54 min

    FC2PPV 1039073 ★ First shot ☆ Active JD Sara-chan, 19 years old ☆ A messy spear man’s plump daughter is in agony with uncle tech ♥ It is decided to be addicted to vaginal cum shot sex! [Personal shooting] * With review benefits!

  • amateur uncensoredfc2
    • 2019-02-27
    26 min

    FC2PPV 1041527 [Screaming sensation local up ver] Loli busty girl ♥ overwhelming neat & simple feeling “I don’t like it ♥♥♥♥♥♥♥” On the verge of fainting slimy massage sensation collapse milk shaking convulsions continuous cum [no

  • amateur uncensoredfc2
    • 2019-03-07
    167 min

    [DANDY-652]"The Young Wife's Big Nipples Are Sensitive After Having A Baby. When I (Pinched/Licked/Twisted) Her Nipples, She Squirted And Repeatedly Asked For More Bareback Sex" vol. 1

  • censoredcreampiesquirtingDANDYdandyparsley okamotoDANDY-652DANDY6521dandy00652
    • 2019-04-19
    239 min

    [YTR-131]Mai Imai, Fucked All Out For 4 Hours

  • mai imai censoredcreampiesingle workYTRnonYTR-131YTR131h-127ytr00131
    • 2019-04-19
    93 min

    FC2PPV 1070159 [HD version] [Uncensored] ★ With 4 major benefits ★ Leopalace21 Secretariat OL Big tits tin ❤j Actually! Erotic underwear w excited even during work with a pervert and a veranda 3P raw squirrel rich ecchi cum shot 2 barrage pink pussy

  • amateur uncensoredfc2
    • 2019-04-20
    120 min

    [VNDS-5181]Special Selections! Rich And Thick And Secret Sex With A Horny Forty-Something Mature Woman

  • censoredmature womanVNDSstar paradisenext toilet rapeVNDS-5181VNDS5181h-254vnds05181
    • 2019-05-04
    228 min

    [HUNTA-592]"Please Let Me Rub My Pussy Against Your Big Cock, That's All I Want To Do..." A Big Sister Is Paying Her Big Dick Little Brother A Reverse Night Visit And Asking For A Pussy Grind! Usually, I Don't Get Along With My Big Si

  • censoredcreampiebig titsHUNTAhunterkawajirihhh groupHUNTA-592HUNTA592hunta00592
    • 2019-05-11
    66 min

    [051119_01]Erina Enomoto

  • erina enomoto uncensored10musume
    • 2019-05-27
    142 min

    [FONE-062]The Baby-Faced Girl With Big, G-Cup Tits Is A Naive Freshman Who Just Moved To Tokyo. Filming Straight After The Interview.

  • censoredbig titsamateurFONEfirst starbig tits first starFONE-062FONE062h-491fone00062
    • 2019-06-14
    107 min

    [NATR-607]Flirting With Widowed Mother-in-law Kimika Ichijo

  • mika ichijo censoredcreampiebig titsNATRpinkbirdman teppeinadeshikoNATR-607NATR607h-067natr00607
    • 2019-07-05
    112 min

    [SNTL-021]Take Her To A Hotel, Film The SEX On Hidden Camera, And Sell It As Porn. A Seriously Handsome Guy vol. 21

  • censoredamateurbeautiful girlSNTLreal.company delusion groupSNTL-021SNTL021sntl00021
    • 2019-07-07
    119 min

    [MIFD-078]3 Day Fuckathon Porn Debut While Boyfriend Is Away Rui Hiiragi

  • scolding censoredbig titsbeautiful girlMIFDmoodyzkyoseimoodyz freshMIFD-078MIFD078mifd00078
    • 2019-08-16
    198 min

    [OYC-271]This Thirty-Something Married Woman Has Been Neglected By Her Husband And Completely Deprived Of Sex, But She's Still Very Pretty And So She Wanted A Professional Photographer To Take Some Pictures Of Her While She Still Had Her Beauty.

  • censoredOYCoyashoku.companyhamonhhh groupOYC-271OYC271oyc00271
    • 2019-09-05
    60 min

    SIRO-3875 [First shot] [Slender beauty] [First mass squirting in life] Slender beauty with big eyes and crispness. Shake your body to adult sex different from your young boyfriend … AV application on the net → AV experience shooting 1056

  • amateur censoredsquirtingamateursirosiro-3875siro3875siro-3875
    • 2019-09-26

    [703_mei_03]プリケツ美人にクンニ／Mei

  • amateur censoredamateurmeimei-03mei03703-mei-03
    • 2019-10-04
    135 min

    [FLAV-228]A Cock-Sucking Perverted Big Tits High School Gal Bukkake Slut Club Tsugumi Morimoto

  • tsugumi morimoto censoredbig titsschoolgirlFLAVdigital arcdigital arkFLAV-228FLAV228flav00228
    • 2019-10-04
    124 min

    [SKSK-011]Karen Mifune x SUKESUKE #011

  • karen mifune censoredbig titsbeautiful girlSKSKprestigesukesukeSKSK-011SKSK011118sksk00011
    • 2019-10-14
    64 min

    SIRO-3895 [First shot] [Adorable beautiful girl] [Plump nice ass] Kansai girls who are full of charm. She screwed her big cock into the naive place and made a violent pant voice and cummed. AV application on the net → AV experience shooting 1088

  • amateur censoredamateursirosiro-3895siro3895siro-3895
    • 2019-10-18
    115 min

    [PARATHD-2717]10 Stepmoms In Their Fifties! I Fucked My Son...

  • amateur censoredstepmomPARATHDparadise tvPARATHD-2717PARATHD2717
    • 2019-11-22
    57 min

    230OREC-422 Rina

  • amateur censoredcreampiebig titsorecorec-422orec422230orec-422
    • 2019-12-13
    90 min

    FC2PPV 1222825 [A Miracle Video That Will Be Lost Even After 10 Years] An I-Cup Huge Breasts Angel Who Is Rumored To Be As Cute As An Idol Goes Crazy On A Swimsuit Pool Date. Video Only Here ≪ №40≫

  • amateur uncensoredfc2
    • 2020-01-19
    170 min

    [HND-784]Secret Hard And Tight Siren Sex Behind The Curtain... My Youth Was Filled With Hard And Tight Piston-Pounding Creampie Sex Behind A Single Thin Curtain Akari Mitani

  • mitani akari censoredcreampieuniformHNDbooktanaka baconHND-784HND784hnd00784
    • 2020-02-18
    59 min

    [021820_01]Yuko Miura

  • yuko miura uncensored10musume



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download