nothing but




FC2NACXLULUONEZABWVENUKBIVEMAAUKGMVSDSQTESHKDGVHDASDGMEMCAWDWAAAAUKSVENXMEYDNATR

2023-04-06
93 min

OKV-004 How Are The Boobs Wrapped In Underwear In Hikaru-Kami Konno'S Clothes, How Are Their Nipples Hidden, What Kind Of Panties Is Their Pussy Covered By Panties, And What About Their Crotch Hair? What If It'S A Shaved Pussy? Av Sent To Adults Who

  • hikaru konno censoredbeautiful girlsingle workOKVpersonal photography of fathergod sukesukeOKV-004OKV0041okv00004
    • 2023-04-06
    144 min

    DRPT-044 They Only Played The Honeycomb Club Nasuka Baseball, But They Were Actually Curious About The Lewd Thing “Please Make A Mess With Me” Natsuka

  • natsuka censoredsquirtingDRPTdennou rasputinlemon heart nakajimaDRPT-044DRPT0441drpt00044
    • 2023-04-05
    65 min

    fc2-ppv 3250561 [First Shot] Raw Vaginal Cum Shot To A Beautiful Ass Married Woman Who Has 10 Cats ☆ "I Like Cats And Men To Be Tsundere. My Husband Is Kind And Elite, But I Have An Affair." ☆ Sensitive Vagina Full Of Love Juice Large Amount

  • amateur uncensored
    • 2023-04-04
    40 min

    fc2-ppv 3249588 *First Limited Quantity 1930pt → 1093pt [Creampie] Only A Few Days Have Passed Since The First Sanction, But A Request For Support Came Again, So I Seeded It Firmly FC2-PPV-3249588

  • amateur uncensoredcreampiemarried woman
    • 2023-04-01
    112 min

    SORA-450 I Don'T Want To Be Seen But I Want To Be Seen, Girls' Marriage Hunting Habits ★ I Love Exposure And Wandering Around The School Naked For Weekend Matchmaking!! When A Student Finds Out About Her Exposed Figure, She Becomes More Captivated By

  • hamazaki mao censoredsingle workSORAyama to soramaboroshikomountains and skySORA-450SORA450sora00450
    • 2023-04-01
    53 min

    040123_01 I Thought She Was A Naive Girl, But I Got A Vaginal Cum Shot In Red Underwear With A Shaved Pussy!

  • miku tadokoro uncensoredcreampieamateur
    • 2023-04-01
    47 min

    fc2-ppv 3205317 [Pajamas Monashi] Pajamas De Ojama ♥ Natural Japanese Beauty Without Custom ♥ She Is 20 Years Old But Has Already Given Birth And Her Breasts Are Bloated ♥ Pies While Enjoying A Too Erotic Feminine Body ♥ FC2-PPV-3205317

  • amateur uncensoredcreampiecosplay
    • 2023-04-01
    60 min

    fc2-ppv 3246209 [Appearance Ban] [Participation Type Orgy] Fluffy Beautiful Milk Girl Who Called Without Telling Anything Was Embarrassed But Felt That She Wet Her Pussy Firmly And Served Several Cocks And Became Covered With Sperm FC2- PPV-3246209

  • amateur uncensored
    • 2023-03-31
    120 min

    NNPJ-548 “Normally I Would Never Follow You” A Girl Who Made Up A Smile And Was Strong, But Got Dumped By Someone She Loved... She Was Lonely And Followed Her Pick Up Teacher. ≪※Super Peeking Girl. ≫ Mizuki-Chan

  • censoredcreampiebeautiful girlNNPJnampa japanNNPJ-548NNPJ548nnpj00548
    • 2023-03-31
    120 min

    CAWD-514 “Cost Reduction! “Moekanchi Come!” The Rookie Manager Who Missed The Last Train Let Me Stay, But... Provoked Me With My Loungewear That Was Too Defenseless!? I Was Turned Into An Idol'S Sexual Desire Treatment Toy And Slutty By Mouretsu All

  • marui moeka censoredcreampieslutCAWDkawaiiyazawa receiveCAWD-514CAWD514cawd00514
    • 2023-03-29
    34 min

    fc2-ppv 3242573 08 Years Old Who Just Graduated In Spring. Untreated Bristles But Innocent And Immature Vaginal Cum Shot 3 Shots While Being Vaginal Cum Shot! Give Rich Semen As A Graduation Gift * The Review Privilege Is 4K High Image Quality FC2-PP

  • amateur uncensoredcreampieuniform
    • 2023-03-29
    129 min

    300MIUM-885 [I Love Vibes. But After All, I Love Chi-ko More. ] Contrary To The Appearance Of A Neat And Clean System, Mr. M Who Is A Vibe Maniac Who Is Masturbating In The Toilet Even During Work. The Mako Trained With A Vibrator Is Super Sensitive,

  • amateur censoredbig titsamateurmiummium-885mium885300mium-885
    • 2023-03-28
    62 min

    032823_01 Amateur AV Interview-I Have A Fulfilling Life, But After All I Want A Chome-Chome, So I Applied For It-

  • amateur uncensoredcreampieamateur
    • 2023-03-28
    102 min

    435MFCS-063 ["I"m Going To Break! No! ] Just Before Fainting! A Masochistic Boyish Beauty Gets A Hard Fuck And Screams Crazy] Encounter With A Black-haired Short-legged Beauty In A Matching App ♪ It"s My First Gonzo, But I Beg For My Favo

  • amateur censoredcreampieamateurmfcsmfcs-063mfcs063435mfcs-063
    • 2023-03-27
    239 min

    MDVHJ-079 “I'M Sorry...” I'M Forcibly Embraced In Front Of A Portrait, But I'M Squeaky... Chapter 2

  • hinami narusawa hotaru mori censoreddramaMDVHJgurafiteijapanshakojimovieMDVHJ-079MDVHJ07948mdvhj00079
    • 2023-03-27
    239 min

    ODVHJ-039 “Maybe I'M Crazy About My Old Lady ●?” Married Women Who Are Made Fun Of With Their Mature Bodies By Young Men On The Train Put Up With It If They Don'T Feel It, But They Give In To Pleasure And Become Comforters For Devil Bastards... 2

  • ayaka muto yurina aizawa censoredcreampieODVHJgurafiteijapansaburo kuromeorgasmODVHJ-039ODVHJ03948odvhj00039
    • 2023-03-26
    37 min

    fc2-ppv 3237815 *Morinashi Bonus Available [Seira Series 4] Make-up Call With Your Boyfriend... But It"s Supposed To Be!!

  • amateur uncensoredamateurcosplay
    • 2023-04-06
    181 min

    DANDY-851 “Huh! My Aunt'S Me?!” Big Butt Mother Who Is Molested In Front Of Her Child And Desperately Resists, But She Drips Her Love Juice And Can'T Stop Climaxing

  • censoredDANDYdandykikujiro ozuDANDY-851DANDY8511dandy00851
    • 2023-03-25
    123 min

    BLOR-213 The Plump Sister At The Indian Curry Shop Usually Has A Flirty Personality, But When She Sees A Dick, She Suddenly Shakes Her Big Butt And Makes Her Cum!

  • censoredBLORburokkori mousou zokubroccoliBLOR-213BLOR213blor00213
    • 2023-03-25
    65 min

    200GANA-2823 281 I"m A Little Nervous About Visiting My Home For The First Time...But If I Press It, I"ll Never Feel Like I"m Going To Fuck It, So I"ll Persuade Him To Have Voyeur SEX! "Having Sex Means Dating...？ ] A Little Heavy

  • amateur censoredamateurganagana-2823gana2823200gana-2823
    • 2023-03-24
    96 min

    SUKE-147 [Z Generation De Nasty Maid] Idol-Faced Beautiful Girl Con Cafe Clerk Is A Hoss Crazy Prostitute Yariman Bitch! ! It’s The Best, But It’s The Best, But It’s The Cowgirl Position That Makes Her Waist Swell. ! [Translation Ali Z

  • amateur censoredcreampieamateursukesuke-147suke147suke-147
    • 2023-03-24
    160 min

    HMN-350 Bss I Liked It First... But One Day, My Childhood Friend Who Robbed Me Of My Virginity Made A Video Call While Having Pov Sex With A Handsome Big Cock Man. No Way... Did You Get Creampied Too? Arai Rima

  • lima arai censoredcreampiebeautiful girlHMNhonnakananzaki masakibookHMN-350HMN350hmn00350
    • 2023-03-24
    200 min

    HUNTB-524 “Wow! “My Underpants Are In Full View...” My Neighbor Was Drunk And Panting In Front Of The Front Door Of My House! I Unintentionally Looked At The Gun, But As A Matter Of Fact, She Looked Like That In Front Of The Entrance

  • censoredcreampieHUNTBhunterkoichi davidsonhhh groupHUNTB-524HUNTB524huntb00524
    • 2023-03-24
    150 min

    HUNTB-523 A Business Trip Housework Agency Service That Cleans While Wearing A Naked Apron! It'S Expensive, But The Housekeeper With Big Boobs And A Big Butt Cleans My Dick Too! So You Can Have As Much Fun As You Want!

  • censoredcreampieHUNTBhunterkawajirihhh groupHUNTB-523HUNTB523huntb00523
    • 2023-03-24
    47 min

    fc2-ppv 3232596 *Limited To 1093pts For The First Time*The Real Face Of A Popular Fortune Teller Who Gets Raped! ! The Other Day I Was Able To Lend Money With My Bag As Collateral, But This Time I Committed It Because I Didn"t Have Anything To Co

  • amateur uncensoredcreampiemarried woman
    • 2023-03-24
    200 min

    HUNTB-535 “Let Me Do Something For You... I Can Only Thank You With My Body” The Super Slutty Girl Who Shows Curly Hair And Has A Loose White Bra Is Stupid But She Is A Super Hard Worker

  • censoredcreampieschoolgirlHUNTBhuntermorikihhh groupHUNTB-535HUNTB535huntb00535
    • 2023-03-24
    74 min

    529STCV-247 [Voyeurism] Voyeurism Of A Certain Active Major Leaguer And An Amateur OL Having Affair Sex In A Place Where His Wife Is Not. I Thought I Was Going To Have Sex Quietly So That I Wouldn"t Get Caught, But I Couldn"t Help But Moan At

  • amateur censoredcreampieamateurstcvstcv-247stcv247529stcv-247
    • 2023-03-23
    194 min

    SW-887 I Happened To See A Schoolgirl'S Punch! You'Ve Seen My Underpants, So Be Prepared! I Thought My Life Was Over When I Was Told, But I'M Horny, So Go Have Sex With Me! I Was Invited To Insert My Dick Into A Schoolgirl'S Pussypussy! We Both Had A

  • censoredSWswitchlight fujimaswitch switchSW-887SW8871sw00887
    • 2023-03-23
    125 min

    AKDL-224 My Child Was Right In Front Of Me, But I Had It With A Single Mother Who Moved Next Door, Too, Nami Suzu

  • monami bell censoreddramaAKDLaquinoriaquinoriaknrAKDL-224AKDL2241akdl00224
    • 2023-03-23
    91 min

    fc2-ppv 3232483 A Freshman In His Teens. I Have A Boyfriend, But My Sensitivity Explodes When I Insert It Without Rubber For The First Time In My Life. After The Act, The Second Round With Wet Hair In The Shower, Continuous Vaginal Cum Shot. FC2-PPV-

  • amateur uncensoredcreampieuniform
    • 2023-03-23
    53 min

    fc2-ppv 3202789 [Uncensored X Personal Photography] A Widow Who Runs A Restaurant That Is In Danger Of Closing Is In A Big Pinch And Has No Choice But To Appear In A Pink Video! FC2-PPV-3202789 FC2-PPV-3202789

  • amateur uncensoredmature womanmom
    • 2023-03-22
    93 min

    fc2-ppv 3229621 During A Fight With My Boyfriend, I Went To My Classmate"s House. Squirting Acme With A Big Cock! At The End, "Don"t Go Inside! ", But... FC2-PPV-3229621

  • amateur uncensoredcreampieamateur
    • 2023-03-21
    73 min

    300MIUM-880 Enchanting Erotic Body [pita Bread Beautiful Big Butt X Beautiful Huge Breasts F Cup] "If You Join Our Community, You Can Get Everything ♪" Nico Nico Recommends Protein & Membership, But Somehow Hotain! It"s Amazing When You T

  • amateur censoredbig titsamateurmiummium-880mium880300mium-880
    • 2023-03-21
    40 min

    fc2-ppv 3228979 [Uncensored] A Neat And Serious Young Lady Who Is A Beginner At Blowjob. Shows Disgust At A Lowly Decachin, But First Challenge To A Long Blowjob

  • amateur uncensoredcreampieamateur
    • 2023-03-20
    89 min

    LBJ-016 Normally, I Almost Always Shoot Wearing Rubber, But Today I Have A Special Vaginal Sex Natural Sex Takarada Monami

  • takarada monami censoredcreampiebig titsLBJwith a buri rian brilliant jizzshirasagi tei burikuraLBJ-016LBJ0161lbj00016
    • 2023-03-18
    53 min

    598HMT-034 [Defeat A Beautiful Big Butt Female College Student With A Good Glue! ] Gonzo SEX With A Constricted Girl Who Is Slender But Has A Big Butt! [College Student/Kamijiri]

  • namichan censoredamateurhmthmt-034hmt034598hmt-034
    • 2023-03-18
    89 min

    CSPL-014 [4K] 4K Revolution Dele Is Cute But... I Can'T Stop. Fujita Kozue

  • kozue fujita censoredcreampiesquirtingCSPLcrystal picturecosdeluxe plusCSPL-014CSPL014cspl00014
    • 2023-03-18
    166 min

    SORA-446 Natsukawa Is An Honor Student Who Is Around Her Age But Doesn'T Wear Makeup. I'M Interested In Romance And Fashion, But I Have Twice As Many Erotic Curiosity “I'M Embarrassed, But I Can'T Control It...” The Student Council President Is A Tru

  • hanaoto urara censoredschoolgirlsingle workSORAyama to sorathin blade purplemountains and skySORA-446SORA446sora00446
    • 2023-03-18
    122 min

    MRSS-143 I Came Across A Scene Where My Wife Was Being Cuckolded, But I Couldn'T Do Anything; I Just Silently Watched My Wife Get Screwed Over And Over

  • sakaegawa noa censoredcreampiesingle workMRSSmisesu no sugao emanuelnortonmrs faceMRSS-143MRSS143mrss00143
    • 2023-03-18
    28 min

    fc2-ppv 3216069 [Individual] A Woman Who Was Abandoned By Her Fiancée. Even Though She Is Poured In The Cloudy Liquid Of Another Person"s Stick Outdoors, She Has No Choice But To Accept It. FC2-PPV-3216069

  • amateur uncensoredcreampiemarried woman
    • 2023-03-17
    150 min

    EBOD-964 The Cutest Short-Cut Girl In School Uniform, Precocious Fcup, Azu Amazuki, Makes Her Exclusive Av Debut, But She Loves An Unrivaled Old Man Who Falls In Love With Her Teacher More Than Her Classmates.

  • amatsuki azu censoreduniformbeautiful girlEBODe bodykyouseiEBOD-964EBOD964ebod00964
    • 2023-03-17
    32 min

    fc2-ppv 3215810 Shooting Negotiations With P Active Girls Of F Cup. I Was Reluctant To Put My Face Out And Insert It, But If I Open The Lid, I Put My Face Out! FC2-PPV-3215810

  • amateur uncensored
    • 2023-03-17
    120 min

    EBOD-966 I Thought My Girlfriend Was Neat, But... Actually, She Was A Real Gal Bitch And Had Perverted Sex With Jerks Who Didn'T Know Me Sora Tenkawa

  • tenkawa sora censoredcreampiesingle workEBODe bodyukichiEBOD-966EBOD966ebod00966
    • 2023-03-17
    54 min

    fc2-ppv 3197658 [Uncensored] When I Met For The First Time In A Long Time, I Turned Into A Super Popular Hostess, But I Can"t Cure My Addiction, And I Have Sex With A Hostess! FC2-PPV-3197658

  • amateur uncensoredcreampieamateur
    • 2023-03-14
    46 min

    fc2-ppv 3204645 "Nymphomaniac Nurse"s Extraordinary Life" "Gonzo Public" "Nao-chan 24 Years Old" Applied For Money But Drowns In Pleasure The Moment When A Nurse Who Can"t Be Imagined From A Quiet Personality Becomes A

  • amateur uncensoredcreampieamateur
    • 2023-03-16
    79 min

    fc2-ppv 3206258 [No Amateur Individual Shooting] Cuckold From A Friend Who Cuckold The Wife Of A Company Executive! I Received A Request To Shoot A SEX Video For My Wife And A Friend, So I Became A Photographer, But I Was Banned From Touching My Frie

  • amateur uncensoredcreampiemarried woman
    • 2023-03-16
    68 min

    345SIMM-809 Akane (18)/I"m Usually A Reserved Girl, But I"m Very Interested In Sex! ？ A Little M Neat And Clean J ♪ [1st Period] Shy To Serve With A Big Cock As Big As Lee (？) ♪ Even If You Get Poked In The Back Of Your Throat, Don"t Let

  • akanechan censoredcreampieuniformsimmsimm-809simm809345simm-809
    • 2023-03-15
    111 min

    435MFC-236 Classy Slut Yuki "Hourly Wage 8000 Yen! ! A Genius Saleswoman Who Reigns At The Top Of The Salesgirl Neighborhood Is Degraded With Alcohol And Pleasure And Devoured Raw Sexual Intercourse] She Looks Graceful But Is Actually A Genuine S

  • amateur censoredcreampieamateurmfcmfc-236mfc236435mfc-236
    • 2023-03-14
    105 min

    261ARA-563 [Huge Breasts And Boobs] [God Milk] "I Came To Take An Etch Course To Satisfy My Favorite Boyfriend W" How Erotic Am I？ Pursue Eroticism For Those Who Like It, Such As Experiments! I Think It"s Okay If You Don"t Have To Go

  • amateur censoredcreampiebig titsaraara-563ara563261ara-563
    • 2023-03-12
    85 min

    DORI-081 Paco Shot No. 81: J●, Who Easily Got Her Man ● Wet With Light Foreplay, Begged Her To “Let'S Put Rubber On...” And Lied That She Understood It, And When She Let Her Guard Down, She Got Caught Off Guard And Inserted It Live! I Was Shaking My

  • censoredcreampieschoolgirlDORIfirst starpakotoriDORI-081DORI081h-491dori00081
    • 2023-03-12
    52 min

    229SCUTE-1328 Maina (21) S-Cute Lolita Face But Cock-loving Vaginal Cum Shot H

  • amateur censoredcreampiebig titsscutescute-1328scute1328229scute-1328
    • 2023-03-11
    149 min

    SCOP-803 When A Sexless And Frustrated Married Woman Is Immersed In Her Daily Vibrator Masturbation Routine From The Middle Of The Day, A Sudden Occurrence Happens Where She Can'T Get Rid Of Her Vibrator!! I Went To The Man'S House Next Door To Ask F

  • censoredcreampieSCOPk m producek tarouscoop kmpSCOP-803SCOP803scop00803
    • 2023-03-11
    128 min

    BAGR-015 I Can'T Help But Fall In Love With Rio Kotomi When She'S Stared At Super Close

  • kotomi rio censoredcreampiebeautiful girlBAGRbarutanminimal iwamuraseijuu shoujoBAGR-015BAGR015bagr00015
    • 2023-03-11
    145 min

    SCOP-802 A Bitchy Gal With Big Breasts Shows Her Thighs And Chest Flickers And Invites Her, But It'S Unbelievably Continued To Orgasm During The Foreplay Stage!! When I Insert My Big Dick, I Get Massive Creampies Into My Little Pussy-Cums Over And Ov

  • censoredcreampieschoolgirlSCOPk m producebakuon analscoop kmpSCOP-802SCOP802scop00802
    • 2023-03-11
    135 min

    GVH-515 She Was An Angel Until She Ejaculated, But After Ejaculation, She Transforms Into A Devil And Fucks Men In Agony With A Cleaning Blow, 180-Degree Vector-Changed Slutty Girl Marui Moeka

  • marui moeka censoredcreampieschoolgirlGVHglory questharuka yukioGVH-515GVH515gvh00515
    • 2023-03-11
    154 min

    REAL-818 I Hate It So Much, But My Sex Compatibility Was Excellent, My Scum Ex Got My Nipples Pinched Up By Him And My Reason Went Wild Over And Over Again, And My Nipples Creamed Over And Over Again Akari Shinmura

  • akari shinmura censoredcreampiesquirtingREALk m producenabereal real worksREAL-818REAL818real00818
    • 2023-03-10
    120 min

    BBAN-406 The Person Who Filled My Painful Body And Loneliness With A Lesbian Housing Complex Was A Woman In The Same Situation Who Was Younger But Had Tolerance And A Big Bust. Komatsu Anmien Waka

  • anzu komatsu misono waka censoredBBANbibiantake dBBAN-406BBAN406bban00406
    • 2023-03-10
    116 min

    HUNBL-128 A Schoolgirl Who Was Supposed To Just Sell Underpants But Was Taken To A Place Where No One Else Was There And Committed A Crime By Force

  • censoredcreampieschoolgirlHUNBLhuntergeminihhh groupHUNBL-128HUNBL128hunbl00128
    • 2023-03-10
    74 min

    fc2-ppv 3199540 "I Can"t Live Because I Have A Boyfriend! 』, But She Is A Puffy Nipple Girl Who Is Swept Away By The Air And Accepts Raw Insertion. FC2-PPV-3199540

  • amateur uncensoredamateur
    • 2023-03-10
    120 min

    JUQ-187 This Is A Story Where She Was Sexually Harassed By Her Strict, Plump Female Boss Who Was Strict With Her Subordinates And Not Only Got Mad At Her, But She Was Even Able To Have Sex. Kusakabe Kana

  • kana kusakabe censoredslutsingle workJUQmadonnabiba gonzoJUQ-187JUQ187juq00187



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download