moe




FC2KBIDASDMARAMIDVVEMAWAAASQTEHDKASSISVENUCESDSPRDMIDEMVSDDTTPREDMEYDONEZGVHVENX

2019-09-24
50 min

FC2PPV 1168103 ☆ First shot ☆ The sunburn marks are dazzling ☆ The black-haired slender beauty who was nervous and mature is too sensitive when the etch starts and panting and rebelling! Gap Moe SEX is a climax of pleasure ♪ [With benefits]

  • amateur uncensoredfc2
    • 2019-09-22
    151 min

    [APKH-117]"I Like Unshowered Cocks..." A Neat And Clean Beautiful Married Woman Who Tries To Hide Her Lust Is Being Filmed Having POV Sex At An Inn Moe Sakurai

  • moe sakurai censoredcreampieblowjobAPKHaurora project annexaurora project anexAPKH-117APKH117apkh00117
    • 2019-09-15
    135 min

    [TIKP-037]We're Dispatching A Beautiful Maso Married Woman Out As A Flesh Fantasy Sex Slave For All The Raw Sex You Can HAndle. Moe Sakurai

  • moe sakurai censoredcreampiesingle workTIKPtikitiki.comerTIKP-037TIKP037tikp00037
    • 2019-09-14
    479 min

    [OFJE-214]Moe Amatsuka Her 5th Anniversary Since Her Debut Best Hits Collection Her Newest 12 Titles 8-Hour Special

  • angel moe censoredschoolgirlbeautiful girlOFJEs one number one styles1 no 1 styleOFJE-214OFJE214ofje00214
    • 2019-09-12
    106 min

    [SILK-119]Hide & Seek V

  • arisa hanyu moe hazuki censoredbig titsSILKsilk labokinoundressSILK-119SILK1191silk00119
    • 2019-09-09
    108 min

    [APNS-139]I'm a Promiscuous Horny Woman At a Banquet... For My Husband's Sake, Today I'm Dirty Again With The Semen of Sweaty Men... Moe Sakurai

  • moe sakurai censoredcreampiesingle workAPNSaurora project annexyukihiro nasuaurora project anexAPNS-139APNS139apns00139
    • 2019-09-05
    166 min

    [SSNI-555]I Can See My Girlfriend's Sister's Panties! My Girlfriend Is Right Next To Us But Her Slutty Older Sister Brazenly Tries To Seduce Me! Moe Amatsuka

  • angel moe censoredslutsingle workSSNIs1 no 1 stylegoemonSSNI-555SSNI555ssni00555
    • 2019-09-05
    119 min

    [JUY-965]In The Afternoon, When Her Husband Isn't There, My Neighbor Invites Me In For Adulterous Creampie Sex - Moe Sakurai

  • moe sakurai censoredcreampiemature womanJUYmadonnajo asagiriJUY-965JUY965juy00965
    • 2019-09-04
    61 min

    [090419-999]Runing And Shaking Heavy Big Tits

  • moe nashiki uncensoredcreampiecaribbeancom
    • 2019-09-01
    43 min

    FC2PPV 1153234 [Make a demon squid with an OL affair wife in uniform, mass bukkake! ] Other married women are screaming in between work w Screaming with a moe voice The married woman who is screaming is the best Eloides w With panchira shooting at th

  • amateur uncensoredfc2
    • 2019-08-22
    140 min

    [SDJS-033]SOD Female Staff Special Edition! Life Is Full Of Ups And Downs! With So Many People Watching, These Girls Can't Help But Be Embarrassed! We Invite Our Users To Show Our Gratitude For Always Supporting Our Movies!

  • have meiko mr koizumi censoredSDJSsod createshuto hoshisod female employeeSDJS-033SDJS0331sdjs00033
    • 2019-08-16
    180 min

    [MADM-117]Big Dicks at the Mixed-Sex Hot Spring - The Young Housewives Get Wet In the Bath: Creampie Adultery Vacation 4

  • naoko akase moe kurashina censoredcreampiebig titsMADMcrystal eizomadam maniacMADM-117MADM11749madm00117
    • 2019-08-08
    134 min

    [SDNM-211]She Puts On A Calm Face, But The Truth Is Her Desires Are Raging! - Moe Sakurai, 29 Years Old - She Secretly Enjoys Adulterous Creampies At A Hot Springs Hotel Only 200m Away From Her Family Home

  • moe sakurai censoredcreampiemature womanSDNMsod createakira saijogenuine married woman the porn experienSDNM-211SDNM2111sdnm00211
    • 2019-08-04
    159 min

    [DIGI-240]HYPER HIGHLEG QUEEN Moe Kurashina

  • moe kurashina censoredslutsingle workDIGIdigital arkdigital ark digital arkDIGI-240DIGI240digi00240
    • 2019-08-03
    155 min

    [SSNI-529]This Beautiful Lady Boss And Her Cherry Boy Employee Ended Up In The Hotel Room During Their Business Trip Together... When She Playfully Started Luring Him To Temptation, He Took Her Gestures Seriously, And Pumped Her Full Of 10 Cum Shots

  • angel moe censoredsingle workSSNIs1 no 1 stylebungo maedaSSNI-529SSNI529ssni00529
    • 2019-07-31
    135 min

    [GVG-915]Sudden 2-Hole Sex With A Maso Married Woman In Her First Anal Fuck Moe Kurashina

  • moe kurashina censoredanalbdsmGVGglory questGVG-915GVG91513gvg00915
    • 2019-07-30
    62 min

    [073019-971]If My Girlfirend Is Moe Nashiki: Heat In The Night

  • moe nashiki uncensoredcreampiehandjobcaribbeancom
    • 2019-07-25
    192 min

    [FSET-840]Schoolgirl's Daring Life! Making Out Public, Golden Shower, And Masturbation With Boyfriend

  • ai mukai rio okita censoredschoolgirlFSETaquinorifsetaknrFSET-840FSET8401fset00840
    • 2019-07-24
    52 min

    [oretd-525]MOE 2

  • amateur censoredcreampieamateuroretdoretd-525oretd525oretd-525
    • 2019-07-22
    43 min

    FC2PPV 1129012 Moe-chan in a super cute twin tail and sailor suit SEX ♡

  • amateur uncensoredfc2
    • 2019-07-11
    132 min

    [SDNM-208]She Has That Somewhat Fragile-Looking Smile, But The Truth Is, She's Hornier Than Anyone On Earth, Right？ Moe Sakurai 29 Years Old Chapter 2 Her Ass Is Trembling And Gushing For With Massive Squirts To The Endless Pleasure She Experienc

  • moe sakurai censoredmature womansingle workSDNMsod createakira saijogenuine married woman the porn experienSDNM-208SDNM2081sdnm00208
    • 2019-07-05
    200 min

    [FCH-035]"You Can't Cum Yet!" This Beautiful Girl Is Teasing Me To Death! My Erection Is At My Upper Limit! The Living Hell And Pleasure Of An Ejaculation Right At The Point Of Detonation! An Exquisite Slow Handjob

  • emi fukada mitani akari censoredbeautiful girlhandjobFCHprestigeFCH-035FCH035118fch00035
    • 2019-07-04
    146 min

    [SSNI-505]Thong Teen Sexual Massage Is Full Of Thick Ass Lolis, Moe Amatsuka

  • angel moe censoredbeautiful girlsingle workSSNIs1 no 1 stylezaku araiSSNI-505SSNI505ssni00505
    • 2019-06-28
    241 min

    [OKAX-526]This Elder Sister Is Using Her Arm And Finger To Take Over A Cock, And After Teasing Her Until She Started Unexpectedly Grinding Her Hips, She Experienced The Ultimate Pleasure Of Continuing Erect Ecstasy

  • miyu saito chuncheon serase censoredsluthandjobOKAXkm produceside dishesOKAX-526OKAX52684okax00526
    • 2019-06-23
    164 min

    [CESD-781]I Pitched This One Prepared For Rejection: What If A Few Straight Girls And One Not-So Straight Girl Were Asked To Go Gay On Camera？ Here's What Happened! This Is One Incredible Girl-On-Girl Movie!!

  • mami kitaura moe hazuki censoredlesbianmature womanCESDceleb no tomoCESD-781CESD781cesd00781
    • 2019-06-21
    203 min

    [FCH-034][Specialized For Streaming] Enjoy Absolute POV Viewing While A Beautiful Girl Tells You How Good You Make Her Feel And She Licks Yuor Nipples, And Gives You So Many Slick And Slippery Handjob Ejaculations That She's About To Pump You Dry

  • scooping arimura nozomi censoredbeautiful girlhandjobFCHprestigefetish partyFCH-034FCH034118fch00034
    • 2019-06-06
    183 min

    [SDJS-020] Cherry Boys Play A Game Of Truth Or Dare With A Harem Of Women And Lose Their Virginity. 5 SOD Female Employees With A Reputation For Being Kind And Beautiful Make Real Viewers Who Are Virgins Cum 10 Times

  • matsuda mio kawai censoredSDJSsod createtiger kosakaisod female employeeSDJS-020SDJS0201sdjs00020
    • 2019-06-06
    156 min

    [SDNM-205]She's Making A Delicate Smile, But Is She Actually Sluttier Than Anyone？ Moe Sakurai 29 Years Old Porn Debut

  • moe sakurai censoredmature womansingle workSDNMsod createakira saijogenuine married woman the porn experienSDNM-205SDNM2051sdnm00205
    • 2019-06-05
    131 min

    [GVG-881]Pussy Device Bondage IX Iron Tied Up Pussy Torture Moe Hazuki

  • moe hazuki censoreddeepthroatsingle workGVGglory questGVG-881GVG88113gvg00881
    • 2019-06-01
    120 min

    [SSNI-482]Young Wife Fucked By Her Father-In-Law Next To Her Husband Moe Tenshi

  • angel moe censoreddeepthroatsingle workSSNIs1 no 1 stylebungo maedaSSNI-482SSNI482ssni00482
    • 2019-06-01
    239 min

    [OFJE-201]"Show Me How You Cum! I Love Semen! I Want To Make You Feel Good With My Mouth!" An Ultra Pleasurable Blowjob Rush Of Pre-Ejaculatory Ecstasy 100 Cum Shots In A Row! 4

  • yua mikami there is hashimoto censoredblowjobbeautiful girlOFJEs one number one styles1 no 1 styleOFJE-201OFJE201ofje00201
    • 2019-05-27
    47 min

    FC2PPV 1094801 [Kuradashi] That 6-month-old Moe-based pregnant woman again ☆ De M Mayu-chan Cosplay & ** Creampie in play ♥ [With high-quality ZIP]

  • amateur uncensoredfc2
    • 2019-05-10
    96 min

    FC2PPV 1083165 [Ultimate Private H] Secretly shoot the whole story up to H with Moe who got drunk and became very erotic ♡

  • amateur uncensoredfc2
    • 2019-05-04
    159 min

    [SSNI-463]Cool And Blunt Student Council President After School Tsundere Filthy Fuck Moe Amatsuka

  • angel moe censoredbeautiful girlsingle workSSNIs1 no 1 stylebungo maedaSSNI-463SSNI463ssni00463
    • 2019-04-19
    238 min

    [DOCP-143]"Seriously, Is She An Angel!？" I Was In The Hospital With Broken Bones And Couldn't Enjoy My Usual Masturbation, And Now My Cock Was At Its Limit! When This Beautiful Nurse Saw Me, She Felt It Was Her Mission To Care For Me, And

  • sakino flower moe hazuki censoredcreampieuniformDOCPprestigedoc premiumDOCP-143DOCP143118docp00143
    • 2019-04-11
    55 min

    FC2PPV 1065113 First shot ☆ 155cm 63kg ☆ Soaked in a sober and mature atmosphere! Gap Moe Namaki-chan, 24 years old, and a vaginal cum shot! [With benefits]

  • amateur uncensoredfc2
    • 2019-04-05
    176 min

    [DOCP-140]I Couldn't Control The Thrill I Felt From The Total Domain Peeking Out From Underneath Her Miniskirt... 2

  • ayu saito mai tominaga censoredDOCPprestigedoc premiumDOCP-140DOCP140118docp00140
    • 2019-04-04
    119 min

    [SSNI-441]How My Fair-Skinned And Slender Girlfriend Was Fucked By 3 Chubby Delinquent Stepbrothers With Big Dicks. Moe Amatsuka

  • angel moe censoredbeautiful girlsingle workSSNIs1 no 1 stylerokusaburo mishimaSSNI-441SSNI441ssni00441
    • 2019-03-22
    240 min

    [YTR-130]Good-Enough Girls Who Get Pumped And Creampie Fucked In 240 Minutes Of Continuous Fucking.

  • nami sekine anri namiki censoredcreampieYTRnonYTR-130YTR130h-127ytr00130
    • 2019-03-06
    149 min

    [SSNI-421]Taking Care Of My Sexual Needs From Morning Till Night: 13 Orgasms! Angelic Nurse Blowjob, Moe Amatsuka

  • angel moe censoredblowjobbeautiful girlSSNIs1 no 1 stylejo styleSSNI-421SSNI421ssni00421
    • 2019-02-21
    183 min

    [SDJS-011]We Asked The Users What Kind Of Orgasms They Wanted To See! "What Happens If You Keep Pleasuring Them Even After They Orgasm And Pass Out？ Can They Reach Climax Just By Listening To Other People Moan？ What Happens If You Alternate Betwe

  • matsuda chika kaneko censoredsquirtingSDJSsod createtakuansod female employeeSDJS-011SDJS0111sdjs00011
    • 2019-02-18
    59 min

    FC2PPV 1036779 [Fire pot] Creampie for a 6-month-pregnant moe-type pregnant woman who has been told by her husband that she is “golden” [Personal shooting] * With review benefits !!

  • amateur uncensoredfc2
    • 2019-02-02
    153 min

    [SSNI-400]A College Girl Who Was Molested Ended Up Hooken On Me And Turned To Me For Sexual Love - Moe Tenshi

  • angel moe censoredbeautiful girlsingle workSSNIs1 no 1 stylejo styleSSNI-400SSNI400ssni00400
    • 2019-02-01
    241 min

    [AVOP-410]1 Million Yen x Creampie Sex What Does A Woman Want, Love, Or Money, Or Creampie Sex!？ 37 Adult Video Actresses In A New Sensation Creampie Survival Game!!

  • hasumi claire tamaki walnut censoredcreampieAVOPhonnakataiga kosakaiAVOP-410AVOP410avop00410
    • 2019-01-21
    237 min

    [XVSR-450]A Virgin Moe Arihana

  • moe arika censoredcreampiebig titsXVSRmax amax ikacalenXVSR-450XVSR450xvsr00450
    • 2018-12-29
    479 min

    [NBES-007]JET Videos 2018 First Half All 43 Titles Special Best Hits Collection

  • tomoka akari airi sato censoredNBESjet videoNBES-007NBES007nbes00007
    • 2018-12-29
    479 min

    [OFJE-181]"No! I Just Came!" Relentlessly Fucking Her Sensitive , Twitching Pussy Straight After She Orgasms! Orgasm Rush. 102 Shots!

  • yua mikami asuka kirara censoredbig titssquirtingOFJEs1 no 1 styleOFJE-181OFJE181ofje00181
    • 2018-12-29
    182 min

    [SSNI-380]Total Domain: Tempting Glances of Moe Amatsuka's Heavenly, Smooth Thighs

  • angel moe censoredbeautiful girlslutSSNIs1 no 1 stylegoemonSSNI-380SSNI380ssni00380
    • 2018-12-22
    162 min

    [JUKF-018]An Unlucky Schoolgirl Who Was Forced To Pay Back Her Father's Underworld Debts The Debt-Ridden Daughter Moe Moe Hazuki

  • moe hazuki censoredbig titsschoolgirlJUKFjumpjump avJUKF-018JUKF018h-227jukf00018
    • 2018-12-19
    40 min

    [230ORE-441]moe

  • amateur censoredcreampieamateuroreore-441ore441230ore-441
    • 2018-12-14
    115 min

    [PARATHD-2471]Business Is Great! A Live Broadcast From A Pussy Hair Club This Is Where You Go To Have A Drink And Some Bush

  • saki mizumi ai rui censoredPARATHDparadise tvPARATHD-2471PARATHD2471parathd02471
    • 2018-12-14
    152 min

    [MDB-968]Cute College Girl Babes In Oversized Sweaters Are Running A Creampie Baths Club

  • mitsuki kamiya naoki kiritani censoredcreampieMDBmedia stationk tarobazookaMDB-968MDB96861mdb00968
    • 2018-12-13
    237 min

    [SSNI-378]S1 15th Anniversary Special. A Huge Collaboration. Part 3. An Extravagant Lineup Of S1 Actresses.

  • yua mikami ayami shunka censoredbig titsbeautiful girlSSNIs1 no 1 styleSSNI-378SSNI378ssni00378
    • 2018-12-07
    187 min

    [CMV-123]The Electric Torture Hospital Ward

  • tsukimiya koharu kagura aine censoredCMVcinemagicmarukatsuvixenCMV-123CMV123cmv00123
    • 2018-12-07
    58 min

    FC2PPV 994255 [Personal shooting] Moe 24 years old, a large amount of vaginal cum shot to a transcendent beauty F cup beautiful breasts dirty nurse

  • amateur uncensoredfc2
    • 2018-12-07
    28 min

    FC2PPV 994101 [First Glasses Bitch] F Cup Big Breasts SS Class Neat and Cute Beautiful Woman Outdoor Orgy Swapping Experienced Hentai "Ah ♥ Ah ♥ Ah ♥" Moe Cute Pant Voice Resonating Sensitive Erection Hidden M Woman Who Writhes With A Clit [N

  • amateur uncensoredfc2
    • 2018-12-06
    120 min

    [SSNI-358]Gang-Banging The Female Announcer In The Office Moe Amatsuka The Gorgeous Caster Falls Prey To The Jealousy Of Her Peers

  • angel moe censoredsquirtingsingle workSSNIs1 no 1 stylerokusaburo mishimaSSNI-358SSNI358ssni00358
    • 2018-12-01
    240 min

    [SQTE-233]S-Cute Yearly Top Sales Ranking 2018 Top 30

  • aoi kururugi abe mikako censoredbeautiful girlSQTEs cuteSQTE-233SQTE233sqte00233
    • 2018-11-22
    142 min

    [IENE-949]Truth Or Dare As The Only Man With My Sister And Her Punk Friends

  • mayu satomi karina matsushita censoredIENEienergykikurinie nergyIENE-949IENE9491iene00949
    • 2018-11-20
    83 min

    [PPMNB-078]Innocent Lucky Star. Moe Minamizawa

  • moe minamizawa censoredsingle workPPMNBintec incPPMNB-078PPMNB078h-706ppmnb00078



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download