javcensored creampie censored sister big butt




FC2HMNAUKGMEYDMILKCJODBBANKSBJHUNTBADNFSDSSABWROYDCHRVSPRDNATRGVHCAWDDASDMVSDSSIS

2024-04-04
89 min

UINAV-004 [1m Over Big Butt] Prip Rideka Ass Sister Is Separated From The Japanese.Drunk And Slut ○

  • censoredcreampieslutUINAVhmn workshamedori.network secondeditionUINAV-004UINAV004h-1472uinav00004
    • 2024-03-29
    160 min

    LULU-287 Academic, The One Who Is One Of The Neat Actors, Her Fair -skinned Butt J"s Sister, She Can"t Stand The Defenseless Panchira Of Her Sister And Rubs Her Panties!In The Confused Gap, I Inserted It And Inserted The Question And Answered

  • kashiwagi konatsu censoredcreampieschoolgirlLULUlunaticsvragmanLULU-287LULU287lulu00287
    • 2024-03-29
    160 min

    LULU-282 "I Don"t Have To Get Married, So Please Give Me Only A Child." She Accepts Her Propensity That She Can"t Do, So She Asked Her To Have A Pregnancy Sperm For Her Boss Her Boss Her Boss.Akari Shinmura

  • akari shinmura censoredcreampiesingle workLULUlunaticsluminaxLULU-282LULU282lulu00282
    • 2024-03-15
    71 min

    300NTK-855 [Beautiful Big Tits G G"s Top Of Top P Live Daughter]!] [Raw Insertion From Support & Raw Blowjob Is Also Roha!!it"s The Best!!] G Fox Erotic Body!!Support Erection With Dosque Vetian & Blow!!Nama Insertion 2nn 5th!!

  • amateur censoredcreampiebig titsntkntk-855ntk855300ntk-855
    • 2024-02-02
    150 min

    MIDV-615 I Made My Naughty Older Sister Who Looks Down On Me Come To Terms With An Obscene Costume! Jinguji Nao

  • jinguji temple nao censoredcreampiecosplayMIDVmoody sgoemonmoodyz divaMIDV-615MIDV615midv00615
    • 2024-01-25
    62 min

    DDH-238 A Sex Friend Woman With An Outstanding Style [Natsuki/27] Who Came With The Intention Of Having Sex Is Overflowing With Pheromones [Natsuki/27] She Gets Serious About Her Partner And Does All She Can With Her Body To Become His Girlfriend.

  • natsuki censoredcreampiebig titsddhddh-238ddh238ddh-238
    • 2024-01-18
    51 min

    DDH-236 A Beautiful Woman Who Wants To Accept The Dick Of The Man She Broke Up With [Umi/28] She Squirts So Much After Having Sex For The First Time In A While That The Sofa In The Room And Her Own Body Are Drenched!

  • amateur censoredcreampiebig titsddhddh-236ddh236ddh-236
    • 2024-01-12
    120 min

    EBWH-049 3 Days Of Sweaty Creampie Sex With My Sister-in-law, Who Is A NEET Mourner Who Reunited After 10 Years, But Whose Breasts Have Grown Splendidly.Azu Amazuki

  • amatsuki azu censoredsistersingle workEBWHe bodyinabarEBWH-049EBWH049ebwh00049
    • 2023-12-30
    70 min

    GESY-028 [Standing] Shy Girl With Big Breasts X Shy But Explosive Orgasm

  • amateur censoredcreampiebig titsgesygesy-028gesy028gesy-028
    • 2023-12-26
    74 min

    EROFV-229 Amateur JD [Limited] Sae-chan, 22 Years Old, Is An Older Sister JD Who Is Proud Of Her Big Boobs And Butt That Immediately Attracts The Attention Of Men! ! Creampie SEX While Being Excited By The Extremely Naughty Plump Body! !

  • censoredcreampiebig titsEROFVhmn workslove girlfriendEROFV-229EROFV229h-1472erofv00229
    • 2023-12-16
    53 min

    GESY-026 A Good Woman Who Unconsciously Makes Men Horny! Sakura, The Unscrupulous Office Lady Whose Boobs And Vagina Are So Beautiful When She Takes Her Clothes Off [clouded Consciousness]

  • amateur censoredcreampiebig titsgesygesy-026gesy026gesy-026
    • 2023-12-15
    240 min

    PBD-455 BEST Cowgirl Position Squeezing Sperm While Looking At You

  • yamagishi ayaka yamagishi aika karen kaede censoredcreampieslutPBDpremiumpremium bestPBD-455PBD455pbd00455
    • 2023-12-11
    50 min

    SIMD-010 It"s More Erotic Than Naked... She"s Slender, But Her Body Line Stands Out Clearly. A Beautiful Woman Wandering Around The City Unprotected In A Tight-fitting Maxi Dress Is Pulled In... [Bread Line/Breast Flash/Clothed/Beauty/Creampi

  • amateur censoredcreampieamateursimdsimd-010simd010simd-010
    • 2023-12-09
    56 min

    GESY-025 I Can"t Leave This Cute Thing Alone...! Nana, A Big-breasted Woman Who Seduces Men While She Sleeps [clouded Consciousness]

  • amateur censoredcreampiebig titsgesygesy-025gesy025gesy-025
    • 2023-12-01
    120 min

    CAWD-601 We"ve Been Living Together For A Week Since My Mother Remarried...I Can"t Control My Horniness And Cum Inside My Older Sister Darashinai"s Defenseless Plump Ass Mai Arisu

  • arisu mai censoredcreampiesingle workCAWDkawaiitake dCAWD-601CAWD601cawd00601
    • 2023-12-01
    150 min

    WAAA-323 24 Shots Of Semen Regurgitation For The First Time In 5 Days Without Being Pulled Out After Being Raped By Nephews Entrusted To Her By Her Sister Ai Sayama

  • sayama love censoredcreampiesingle workWAAAones factorywanzWAAA-323WAAA323waaa00323
    • 2023-12-01
    160 min

    LULU-255 Aiming To Find A Gap In The Heart Of My Neighbor, A Big-assed Office Lady Who Broke Up With Me Just Before Getting Married, I Attempted To Comfort Her And Have Sex With Her, Even Though She Is A Virgin.She Came To My First Squirt And Fell In

  • honda hitomi censoredcreampiesingle workLULUlunaticsnagases wingLULU-255LULU255lulu00255
    • 2023-12-01
    160 min

    LULU-261 A Voluptuous, Half-big-assed Older Sister Living In Roppongi, Minato-ku, Tokyo Forced Me To Have Sexual Intercourse With Her, And She Had A Screaming, Crazy Creampie SEX Where She Slammed Her Ass And Made Me Cum In Her Vagina Over And Over A

  • kato rose censoredcreampiesingle workLULUlunaticsluminaxLULU-261LULU261lulu00261
    • 2023-12-01
    170 min

    MIDV-553 I Was Made To Ejaculate 40 Times By My Private Tutor"s Older Sister During A 24-hour X 7-day Sexual Intercourse With My Parents While She Was Away. Jinguji Nao

  • jinguji temple nao censoredcreampieslutMIDVmoody strendy yamaguchimoodyz divaMIDV-553MIDV553midv00553
    • 2023-11-30
    280 min

    GGDR-001 Everyone Is Super Cute! Super High Level Amateur! Giga De Rein"s Carefully Selected Bombshell BEST! ! Vol.01

  • censoredcreampieamateurGGDRrein gigadeGGDR-001GGDR001h-1758ggdr00001
    • 2023-11-23
    196 min

    NHDTB-849 My Gal Sister-in-law Secretly Rides Me While Wearing My Clothes, And I Cum Inside Her.

  • censoredcreampieschoolgirlNHDTBnatural highkansukeNHDTB-849NHDTB8491nhdtb00849
    • 2023-11-18
    47 min

    GESY-022 A Girl Who Looks Sexy Even When She"s Asleep! Miyabi, A Big-breasted Office Lady With An Amazing Erotic Body [clouded Consciousness]

  • amateur censoredcreampiebig titsgesygesy-022gesy022gesy-022
    • 2023-11-11
    52 min

    GESY-021 When I Took It Off, I Was Shocked To See Huge Breasts! Behind The Friendly Smile...A Talented Woman Is An Office Lady Who Hides Her Breasts [clouded Consciousness]

  • amateur censoredcreampiebig titsgesygesy-021gesy021gesy-021
    • 2023-11-10
    120 min

    JUQ-458 While My Wife Was On A Business Trip, I Was Seduced By My Sister-in-law, Nao, And We Had Intense Creampie Sex Until The Sperm I Had Stored For 30 Days Was Emptied... Jinguji Nao

  • jinguji temple nao censoredcreampiesingle workJUQmadonnablueJUQ-458JUQ458juq00458
    • 2023-11-10
    83 min

    546ERHV-027 Frustrated, A Super Cute Gal With An Old Man Fetish. She Gives A Blowjob With A Sticky Tongue Technique, And Her Beautiful Big Breasts And Beautiful Butt Come Close To You In The Cowgirl Position. She Pretends To Be Greedy And Has Crazy C

  • amateur censoredcreampiebig titserhverhv-027erhv027546erhv-027
    • 2023-11-04
    139 min

    PKPD-268 Completely Private Video - First Sleepover With Yuuri Oshikawa, The Enchanting I-cup Beauty Who Celebrated Her 10th Anniversary.

  • yuri sugawa censoredcreampiesingle workPKPDpakopako team and pleasant friends delusion groupPKPD-268PKPD268pkpd00268
    • 2023-10-30
    107 min

    SUKE-178 [Dynamite Beautiful Body Of A New Z-generation Office Worker] In Her First Year At The Company, Everyone In The Company Is A Brother! ？ A Big Orgy With An Older Sister With A Lewd Body Who Is Very Weak When Pushing. Good Breasts, Good Butt,

  • amateur censoredcreampiebig titssukesuke-178suke178suke-178
    • 2023-10-21
    49 min

    GESY-018 An Extremely Likeable Female College Student Whose Breasts Are Punk But Her Dreams For The Future Are A Bit Modest [Consciousness Clouded]

  • amateur censoredcreampiebig titsgesygesy-018gesy018gesy-018
    • 2023-10-14
    130 min

    KHIP-017 When I Moved To A New House, I Became My Next-door Neighbor, And I Begged A Lot Of Times To Beg A Big-assed Lady Who Was Weak Against Pressure, And When She Finally Let Me Have Sex With Her, The Single Office Lady"s Sexual Desire Was So

  • mizuki yayoi censoredcreampiesingle workKHIPprincess kaguya pt delusional familynortonkaguya hipKHIP-017KHIP017khip00017
    • 2023-10-14
    47 min

    GESY-017 超絶超乳でも態度は控えめな可愛い女子大生さえ【意識混濁】

  • even censoredcreampiebig titsgesygesy-017gesy017gesy-017
    • 2023-10-07
    67 min

    GESY-016 When We Met For The First Time, I Couldn"t Help But Notice That Her Boobs Were Huge! Reina, A Wild-bodied Beauty Who Makes You Say [clouded Consciousness]

  • amateur censoredcreampiebig titsgesygesy-016gesy016gesy-016
    • 2023-10-06
    130 min

    DASS-231 I Squeezed The Big Butt Of My Older Sister Who Was Showing Off Her Black Pantyhose Defenselessly And Creampied Her. Natsu Tojo

  • natsu tojo censoredcreampieDASSdasskonjac kanoDASS-231DASS231dass00231
    • 2023-09-30
    160 min

    LULU-247 I Made My Girlfriend"s Younger Sister, Who Is Strong And Boyish, Drink An Aphrodisiac And Continue To Tease Her By Inserting 1cm Of The Tip, And Made Her Ejaculate With A Piston That Hits The Back Of Her Vagina, Making Her Into A Sexual

  • monami bell censoredcreampieschoolgirlLULUlunaticsnagases wingLULU-247LULU247lulu00247
    • 2023-09-15
    120 min

    PTU-005 PEA Channel 5 Can You Pay For A Taxi With Your Body？ ？ You"ll Be Shocked To See What Will Happen If You Ask Her To Have Sex During The Preview! !

  • hanayanagi anna niiyama chinatsu censoredcreampiePTUpeatubeuchiyamaPTU-005PTU005h-1727ptu00005
    • 2023-09-09
    125 min

    KHIP-016 A Big Ass Older Sister Who Became A Neighbor When She Moved And Was Weak To Push Her Sexual Appetite. Mihina

  • mihina azumihina mihina nagai censoredcreampieslutKHIPprincess kaguya pt delusional familynortonkaguya hipKHIP-016KHIP016khip00016
    • 2023-09-09
    68 min

    761GESY-012 I Fuck A G-cup Dental Hygienist. Meari, A High-spirited Criminal With Beautiful Breasts [clouded Consciousness]

  • amateur censoredcreampiebig titsgesygesy-012gesy012761gesy-012
    • 2023-09-08
    150 min

    BANK-142 Creampie Open Air Hot Spring Voluptuous K Cup Nasty Older Sister Hana Haruna

  • haruna hana censoredcreampieuniformBANKmako banktake chanBANK-142BANK142h-1495bank00142
    • 2023-09-07
    232 min

    MFT-008 "Would You Like To Raise A Virgin？"Suddenly, My Sister-in-law (gal) Offered To Teach Me SEX! When I Thought That It Would Be A Sweet Memory At This Place ... "Do You Know What You Will Do From Now On？" Suddenly A Continuous Ej

  • censoredcreampiebeautiful girlMFTworks faleno tubedazai chinpoMFT-008MFT0081mft00008
    • 2023-08-27
    119 min

    300MIUM-959 [G-cup Dental Hygienist] Reverse Pick-up Of An Erotic Sister With A Perfect Body! ! Forbidden Cuckold Document! ! Seduce Men Who Have Girlfriends And Bring Them Into Angry Slut Sex! ! Moist Older Sister Squeezes Sperm With Explosive G Mil

  • amateur censoredcreampiebig titsmiummium-959mium959300mium-959
    • 2023-08-12
    132 min

    MRHP-024 A Big Ass Married Older Sister Who Lives In The Same Apartment And Is Unconsciously Tempted To Seduce Me In Pitapita Jeans, And I Can"t Stand It, And I Cum Every Day Erika Ozaki

  • ozaki erika censoredcreampiesingle workMRHPmrs emmanuelnortonmrs assMRHP-024MRHP024mrhp00024
    • 2023-08-04
    100 min

    HUNTB-686 "I"ll Wash You With My Boobs!" "Then I"ll Wash You With My Butt!" "Because I Want To Get Along With My Brother More!"

  • censoredcreampiesisterHUNTBhuntermorikihhh groupHUNTB-686HUNTB686huntb00686
    • 2023-07-28
    120 min

    MIAA-921 My Neighbor, Who Misunderstood The Temptation Of An Unaware Big Ass Wife"s Sheer Bread As An Adultery OK Sign, Made Me Vaginal Cum Shot Many Times With A Runaway Piston That Shakes My Ass. Luna Tsukino

  • tsukino luna censoredcreampiesingle workMIAAmoody sdragon nishikawaeveryone s kikatanMIAA-921MIAA921miaa00921
    • 2023-07-28
    170 min

    JUFE-498 Pheromone Overflowing Older Sister"s Hidden Obscene Propensity! Show Off Your Smelly Ass Hole And Let Me Lick It Plump Big Ass Human Bullet Temptation Mina Kitano

  • mina kitano censoredanalcreampieJUFEfitchJUFE-498JUFE498jufe00498
    • 2023-07-26
    66 min

    326NOL-030 [Superb View Cowgirl With Beautiful Big F Cup Swaying] Gachinko Gonzo With A Total Of 4 Ejaculation With An Older Sister-type Galva Clerk Who Has A Preeminent Style That Makes A Man Lustful With Her Erotic Body And Panting Voice! !

  • ellie censoredcreampiebig titsnolnol-030nol030326nol-030
    • 2023-07-21
    120 min

    HMN-443 Akari Mitani"s One Week Butt Routine Spending With A Masochist Kun ~ Every Day She Enjoys A Powerful Facesitting And Creampie Sex With A Shaking Beautiful Ass ~

  • mitani akari censoredcreampiesingle workHMNbookkuri chanHMN-443HMN443hmn00443
    • 2023-07-14
    120 min

    MIAA-904 I Can"t Stand The Temptation Of My Sister-in-law"s Pita Bread Deca-ass, And While My Brother Is Absent, I"m A Freeloader Who Cums Many Times With A Back Piston. Jun Suehiro

  • suehiro jun censoredcreampiesingle workMIAAmoody scomet akaieveryone s kikatanMIAA-904MIAA904miaa00904
    • 2023-07-06
    136 min

    MIST-407 YAPPA! Yurika Aoi A High-Career Actress Wants To Show Her The Most Eros Perverted Slut Older Sister Who Uses All Her Skills To Have Sex With A Lady Comic

  • yurika censoredcreampiesquirtingMISTmr michirusteven sorterbergMIST-407MIST4071mist00407
    • 2023-06-28
    74 min

    BDDA-031 Sexual Desire Bug Woman. Indecent Butt! Indecent Vagina! Dirty Face! Indecent Milk! Unequaled Nasty De M Perverted Amateur Nozomi-chan Nozomi Arimura

  • arimura nozomi censoredcreampiebig titsBDDAbuddha buddhadevbuddha buddha buddhaBDDA-031BDDA031h-1613bdda00031
    • 2023-06-22
    93 min

    326FCT-017 The Second Round Of Vaginal Cum Shot To Intelligent JD Who Is Enrolled In The Pharmacy Department Who Is Good At Pampering! ! 102cm Big Breasts Shaking Brun Brun At The Woman On Top Posture Breaks The Limit! !

  • amateur censoredcreampiebig titsfctfct-017fct017326fct-017
    • 2023-06-15
    89 min

    PTU-002 PEA Channel 2 I Tried To Verify If I Was 20 Years Old, And I Could Control My Sexual Desire By Taking A Bath With My Dad! ! Surprise I Blindfolded Her Friend"s Girlfriend And Switched During Sex! !

  • mita sakura suwon miso censoredcreampiePTUpeatubeuchiyamaPTU-002PTU002h-1727ptu00002
    • 2023-06-03
    160 min

    LULU-218 My Father"s Remarriage Suddenly Made A Namaiki Deca-ass Neo Gal J-kei Younger Sister Irritated Me With Panchira Provocation, So I Made A Virgin Immediately Saddle Preaching Piston Many Times And Made It Understand. Satsuki Ena

  • ena satsuki censoredcreampieschoolgirlLULUlunaticsvragmanLULU-218LULU218lulu00218
    • 2023-06-03
    130 min

    390JAC-171 [Various Vaginal Cum Shots 13! ! ] Neat And Clean Horny Older Sister Who Is Frustrated Enough To Masturbate While Going Around Breaks Her Own Shell And Blooms! ! ! I"m Going To Have A Good Time With 3 Physical Big Cock Actors! ! ! [Mou

  • amateur censoredcreampiesquirtingjacjac-171jac171390jac-171
    • 2023-05-19
    170 min

    CJOD-386 Big Ass Older Sister Comes To A Slut Creampie OK Rejuvenated Asian Men"s Esthetic Alice Oto

  • otsu alice censoredcreampieslutCJODslut havenhiroharu osakiCJOD-386CJOD386cjod00386
    • 2023-05-19
    130 min

    HMN-390 Protein (Semen) Desires Unstoppable Deca-Ass Trainer Squeezed Many Shots At Stakeout Woman On Top Posture Chintre Chanyota

  • chanyota censoredcreampieslutHMNbookhimopan of joytoyHMN-390HMN390hmn00390
    • 2023-05-12
    240 min

    PBD-441 I Was Slutty By Piling Up 60 Shots In The Riding Position That I Could See My Beautiful Older Sister'S Buttocks... Best

  • aika yamagishi karen kaede censoredcreampieslutPBDpremiumpremium bestPBD-441PBD441pbd00441
    • 2023-05-12
    120 min

    HMN-396 I Seen My Husband And My Sister-In-Law Masturbating In The Shower While She Was Exhausting... She Got Wet And Fucked Hard While Her Hair Was Wet!! Suehiro Jun

  • suehiro jun censoredcreampiesingle workHMNbookmamezawa mametaroHMN-396HMN396hmn00396
    • 2023-04-28
    122 min

    HODV-21759 My Girlfriend'S Older Sister, Who Doesn'T Have A Lot Of Sexual Desire, Runs Wild With Her Plump Big Butt! I Was Slutty By Piling Up Pile All The Time, And It Went On Me! Taki Yuina

  • taki yuina censoredcreampieslutHODVh m pk c takedaHODV-21759HODV217595642hodv21759
    • 2023-04-21
    135 min

    ROYD-124 My Sister-in-law Who Seduces Me Unconsciously Has A Big Butt! Marui Moeka

  • marui moeka censoredcreampiebeautiful girlROYDroyalROYD-124ROYD124royd00124
    • 2023-04-21
    171 min

    HUNTB-492 "What A Dress!" When I Opened The Door Of The Room, My Sister-in-law"s Big Butt Was Fully Opened! My Sister-in-law, Who Is Usually Defenseless, Crawls On All Fours Without Shame And Exposes Her Ass! So Much Butt...

  • amateur censoredcreampieHUNTBhunterHUNTB-492HUNTB492huntb00492
    • 2023-03-25
    242 min

    NASH-865 Massive Firing On A Plump Plump Sister'S Huge Breasts And Butt For 4 Hours

  • censoredcreampiebig titsNASHpinknadeshikoNASH-865NASH865nash00865



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download