jav high vision upskirt school uniform schoolgirl




FC2MEYDNACRMARAFSDSSCAWDPREDDASDMIAAADNMILKAPODSANWANZSPRDKBIVENUONEZJULDTTRBD

2022-02-01
120 min

[BUBB-114]S********l Staircase Fun: 100 Irresistible S********l Thighs SPECIAL!

  • censoreduniformschoolgirlBUBBeitentatsuzo fujidabukatsudoBUBB-114BUBB114436bubb00114
    • 2022-01-01
    122 min

    [BUBB-113]Stairway S********l I"d Feel Irresistible If It Was A S********l In A Thong, Ed.

  • censoreduniformschoolgirlBUBBeitentatsuzo fujidabukatsudoBUBB-113BUBB113436bubb00113
    • 2021-12-24
    150 min

    [SSIS-282]My Usually Quiet S*****t Seduces Me With Her Panting With Conviction Only In Front Of Me.

  • kosui jun censoreduniformschoolgirlSSISs1 no 1 styletrendy yamaguchiSSIS-282SSIS282ssis00282
    • 2021-12-23
    218 min

    [SW-820]Nice Panty Shot From A S********l! Catching Sight Of S********ls In Skirts Every Day When The Breeze Picks Up And Reveals What"s Under Those Skirts, Getting A Sneaky View Of Those Pale Young Thighs And Ample Asses Wrapped In White Panties

  • censoreduniformschoolgirlSWswitchlight fujimaswitch switchSW-820SW8201sw00820
    • 2021-12-10
    234 min

    [HUNTB-157]"Ouch!" Girls Hits Me Down Below By Mistake During An Airsoft Game! "It"s Your Fault I"m Not Hard!" Sorry, What Should I Do？" "Let Me See Your Underwear For Now..."

  • censoredcreampieschoolgirlHUNTBhunterkoichi davidsonhhh groupHUNTB-157HUNTB157huntb00157
    • 2021-12-09
    128 min

    [FGAN-053]Club Uniform Girl Cosplay Fetish Video Yua Kawaei Yua

  • kawaei yui censoredschoolgirlsingle workFGANfechi mefetish eyesFGAN-053FGAN053h-1440fgan00053
    • 2021-09-17
    238 min

    [MUKD-466]She"s Spreading Her Shameful Pussy Wide! Her Sensuality Rises As She Shows You Everything!! A Beautiful Y********l In Uniform Descends Fully In Pleasure, Panting And Moaning Like A Whore As She Shows You How She Finger Bangs Herself To

  • censoreduniformschoolgirlMUKDmukuMUKD-466MUKD466mukd00466
    • 2021-09-10
    195 min

    [HUNTB-094]Naughty Sounds Of Knocking Boots At The Library! When A S********l Comes Across Erotica Her Panties Get So Drenched That She"s Down For A Quickie!

  • censoredcreampieschoolgirlHUNTBhunterkawajirihhh groupHUNTB-094HUNTB094huntb00094
    • 2021-08-20
    142 min

    [CAWD-265]A Beautiful Y********l in Uniform Who Wants Some Pocked Money, So She Skipped School To Suck Off Some Disgusting Older Guy - Ren Midorika

  • midoriya ren censoreduniformschoolgirlCAWDkawaiiCAWD-265CAWD265cawd00265
    • 2021-07-02
    119 min

    [SSIS-112]Gorgeous Teen In Uniform Loves 4 Older Guys - Three Immoral Fucks And Passionate Blowjobs Kozue Fujita

  • kozue fujita censoreduniformschoolgirlSSISs1 no 1 styleoosaki hirokoujiSSIS-112SSIS112ssis00112
    • 2021-06-04
    201 min

    [HUNTB-023]Is This The Stairway To Heaven...？! Flashed With A Panty Shot By A Slutty Older Schoolmate On The Stairs, You Got An Erection, But When She Saw It She Offered To Cut Class And Fuck You On The Roof...!

  • censoredcreampieschoolgirlHUNTBhuntercognac kaminohhh groupHUNTB-023HUNTB023huntb00023
    • 2021-04-27
    130 min

    [HOME-001]Sugar Baby In A One-Bedroom Apartment - Older Guy Nails His S********l Fuck Buddy For One Whole Day Of Creampie Sex

  • censoredcreampieschoolgirlHOMEfirst star100 raw styleHOME-001HOME001h-491home00001
    • 2021-04-14
    234 min

    [HUNTA-988]"My Body Isn't Enough Thanks For You？ I'm Not Just A K*d, You Know..." Runaway S********l Takes Over My Room, But She's So Cute That I Don't Really Mind...

  • censoredcreampieschoolgirlHUNTAhuntercognac kaminohhh groupHUNTA-988HUNTA988hunta00988
    • 2021-04-09
    120 min

    [MIAA-419]Cute Seductive S*********ls In Uniform Tempt You With A Smile... Slut Siren tly Ravishes You Asuka Momose

  • momose asuka censoredcreampieschoolgirlMIAAmoodyzwild seveneveryone s porn starMIAA-419MIAA419miaa00419
    • 2021-04-09
    145 min

    [SKMJ-158]Slip Your Dick Into This Big Ass Sch**lgirl From Behind For Some Quickie Action! This Beautiful Y********l In Uniform Works Part-Time At A Housecleaning Service And When She Came To Your House You Couldn't Resist The Temptation Of Her M

  • censoredcreampiebig titsSKMJred face girlswing nagaseSKMJ-158SKMJ158h-1324skmj00158
    • 2021-03-20
    119 min

    [SPZ-1098]Seducing A Serious-Looking Girl In A School Uniform Wearing Stockings Stalking Sneaking Can't Make A Noise

  • censoredschoolgirlSPZstar paradisestar paradiesSPZ-1098SPZ1098h-254spz01098
    • 2021-03-18
    218 min

    [HUNTA-976]There's This Latchkey Girl Who I Often See Around My Apartment Complex, And I Realized That She Was Lonely, So When I Treated Her Nicely, She Came Over To My Place, And Didn't Refuse To Have Sex, So She Gave Me A Blowjob, And We Ha

  • censoredcreampieuniformHUNTAhunterkawajirihhh groupHUNTA-976HUNTA976hunta00976
    • 2021-02-06
    190 min

    [HUNTA-938]The 3rd Year Class 4 Group Put Out A Refreshment Booth At The Cultural Fair... And It Turned Out To Be A Go Go Bar At The Cultural Fair Of This Private Young Ladies' Academy The Most Popular Refreshment Booth Every Year, Which Has Line

  • censoredcreampieschoolgirlHUNTAhuntermasanorihhh groupHUNTA-938HUNTA938hunta00938
    • 2021-01-16
    113 min

    [ROYD-037]I Confessed My Love For The First Time To The No.1 Slut At School! "If We're A Good Match Sexually, I'll Go Out With You!" And Then She Gave My Cherry Boy Cock A Test Ride! Yui Kawai

  • yui kawai censoredcreampieschoolgirlROYDroyalcognac kaminohhh groupROYD-037ROYD037royd00037
    • 2020-11-20
    229 min

    [SIM-097]"I Love You Stepdaddy" He Got Remarried And Got A New Stepdaughter Who Loves Dirty Old Men. While Mom's Away, This Little Devil Is Luring Her Stepfather To Temptation For Adultery Sex All Throughout The House!

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-097SIM097118sim00097
    • 2020-11-20
    239 min

    [SIM-098]I Came Too Much While Walking The Streets... This J* Had A Remote-Controlled Vibrator Installed In Her Pussy While She Took A Walk!

  • censoredcreampieschoolgirlSIMprestigeamateur pussiesSIM-098SIM098118sim00098
    • 2020-10-17
    199 min

    [HUNTA-868]Defenseless Upskirt Footage, On Purpose？ The Girls In The Library Committee I'm On Have Short Skirts, And Every Time They Take Something Or Crouch Down, I Get Panty Shots...

  • censoredcreampieschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-868HUNTA868hunta00868
    • 2020-10-03
    479 min

    [HHGT-004]Golden Time: Carefully Selected Female S*****ts SP

  • censoreduniformschoolgirlHHGTgolden timehhh groupHHGT-004HHGT004hhgt00004
    • 2020-09-05
    53 min

    [HHKL-062]S********l Working Part Time At A Supermarket Still In Her Uniform Innocently Flashes Her Panties And I'm So Horny I Could Explode!

  • censoredschoolgirlHHKLhunterkoichi davidsonhhh groupHHKL-062HHKL062hhkl00062
    • 2020-08-01
    216 min

    [HUNTA-819]"Oh, Perhaps You're Trying To Tempt Me？" This S********l Works Part-Time At A Supermarket In Her School Uniform, And She's Flashing Unguarded Panty Shot Action At Me, And It's Getting My Dick Rock Hard! And Then She Cau

  • censoredschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-819HUNTA819hunta00819
    • 2020-07-16
    240 min

    [HUNTA-814]"They Won't Catch Us In Here" Trying To Be Quiet While Fucking My Grown-Up Step-Niece In A Closet - Her Parents Are Right In The Next Room

  • censoredcreampieschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-814HUNTA814hunta00814
    • 2020-07-01
    120 min

    [BUBB-095]A S********l Standing On The Stairs White Panties Galore! A Complete Collection

  • censoreduniformschoolgirlBUBBeitentatsuzo fujidabukatsudoBUBB-095BUBB095436bubb00095
    • 2020-06-11
    230 min

    [SW-708]A Youthful Offline Fuck With A S********l Who Loves Sex That He Met On Social Media 3

  • censoreduniformschoolgirlSWnatural highswitch switchSW-708SW7081sw00708
    • 2020-05-21
    239 min

    [SW-705]A Youthful Offline Fuck With A S********l Who Loves Sex That He Met On Social Media 2

  • censoreduniformschoolgirlSWswitchswitch switchSW-705SW7051sw00705
    • 2020-04-11
    196 min

    [MIRD-201]Beautiful Y********l Panty Shot Harem Hot Y********ls Love To Make Cocks Explode Akari Mitani Mitsuki Nagisa Miku Abeno

  • mitani akari scooping censoreduniformschoolgirlMIRDmoodyzdragon nishikawamoodyz realMIRD-201MIRD201mird00201
    • 2020-02-28
    239 min

    [OKAX-596]Fucking Forbidden! Testing The Options At A Secret Sexual Massage In The City! CCD Peeping 240 Min

  • censoreduniformschoolgirlOKAXk m producedick mandokuokazuOKAX-596OKAX59684okax00596
    • 2020-02-01
    177 min

    [HUNTA-721]Inside The Foot Warmer, It Was Panty Shot Heaven! I'm Getting All The Cotton Panty Shot Action I Can Handle! Those Panties Are Bulging So Hard I Can See Their Cameltoes And That's Got My Dick Rock Hard! All Of These Little Honies C

  • censoredschoolgirlHUNTAhunterkawajirihhh groupHUNTA-721HUNTA721hunta00721
    • 2019-12-28
    180 min

    [HUNTA-706]My Room Became A Hangout For The Girls From My Class, And Now It Was Like Panty Shot Heaven!! My Parents Are Usually Out Of The House Because They're Working, And Before I Knew It, These Classmate Girls Were Spending Their Time At My P

  • censoredcreampieschoolgirlHUNTAhuntercognac kaminohhh groupHUNTA-706HUNTA706hunta00706
    • 2019-09-27
    174 min

    [FNEO-039]Attention All Men! Be Cautious Of Girls In The Library! "Shhhh! Be Quiet Or You'll Get In Trouble! But On The Other Hand..." Unable To Resist Her Sexy Temptation In The Library, You're On The Prowl For That Prim And Proper G

  • yuri fukada ai minano censoredcreampieschoolgirlFNEOfirst staryosukefirst star neoFNEO-039FNEO039h-491fneo00039
    • 2019-09-14
    195 min

    [HUNTA-654]"Are You Showing Me Your Panties On Purpose？" There's A High School Girl Working Part-Time At The Bakery Where I Work, And She Keeps Her School Uniform On, Making Her 130 Cute!

  • censoreduniformschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-654HUNTA654hunta00654
    • 2019-09-12
    159 min

    [SW-654]The Beauty Of A Sch**lgirl In A Ponytail, The Nape Of Her Neck, And Her Panty Shot Pleasure I Was Longingly Looking At Her As She Tied Up Her Hair, And She Was Embarrassed To Be Seen Lifting Her Armpit, And That Made My Heart Leap With Excite

  • censoredschoolgirlSWswitchlight fujimaSW-654SW6541sw00654
    • 2019-08-08
    186 min

    [SW-649]Do You Want To See My Panties？ Well Then I'll Show You! My Classmate Akari-san Always Treats Me Like A Kid. But One Day, Calling It A Special Treat, She Lifts Up Her Skirt And Shows Me Her Panties! It's The Best Day Of My Life! - Akar

  • akari neo censoredschoolgirlsingle workSWswitchlight fujimaswitch switchSW-649SW6491sw00649
    • 2019-08-04
    135 min

    [DVDMS-432][Raw Fucking Sch**lgirl Selfies] She Tempted Her Friend's Big Brother With Panty Shot Action And Got Him Nice And Hard, And Then She Domesticated Him Into Her Obedient Cock So She Could Have Sex Whenever She Wanted

  • censoredcreampieschoolgirlDVDMSdeep shiromichi hoseDVDMS-432DVDMS432dvdms00432
    • 2019-07-13
    206 min

    [HUNTA-627]Unguarded Panty Shot Action! Is She Doing It On Purpose？ 2 I Work Part-Time At A Convenience Store, And This Sch**lgirl Works There While Wearing Her School Uniform, And Since Her Skirt Is So Short, Whenever She Reaches Up High To Get Some

  • censoreduniformschoolgirlHUNTAhunterkoichi davidsonhhh groupHUNTA-627HUNTA627hunta00627
    • 2019-07-13
    156 min

    [SSNI-520]Total Domain. She'll Constantly Tempt You With Her Beautiful, Slim Thighs. The Bewitching Beauty In Knee-High Socks. Arina Hashimoto

  • there is hashimoto censoredschoolgirlsingle workSSNIs1 no 1 stylemichiru arashiyamaSSNI-520SSNI520ssni00520
    • 2019-06-06
    195 min

    [SW-636]You Like Looking Up Schoolgirl's Skirts, Don't You？ My Adorable Cousins From The Countryside Keep Trying To Seduce Me!

  • censoredSWswitchlight fujimaswitch switchSW-636SW6361sw00636
    • 2019-05-23
    100 min

    [GS-260]I Was Unexpectedly Turned On By The Sight Of This Sch**lgirl In Her Uniform, Standing At The Bookstore And Browsing In Her Short Skirt, So I Found Myself Peeping Some Panty Shot Action. But Seriously, She Didn't Catch On To Me, So I Went

  • censoredcreampieschoolgirlGSsosoru x garconikebukuro store managerGS-260GS2601gs00260
    • 2019-05-23
    215 min

    [SW-632]If You Wanna See A Schoolgirl's Panties, Give Me Money! My Cute Cousins Come To My Place Every Day And Pester Me For Money In Return For Playing With Me And Helping Me Around The House While Flashing Their Panties! They Said They'd Ne

  • censoredSWswitchlight fujimaswitch switchSW-632SW6321sw00632
    • 2019-03-20
    99 min

    [ARM-746]Don't Look At My Panties! She Fights Back With More Embarrassment! The Schoolgirl "Leg Scissors" My Face With Her Thighs

  • hinano kanzaka miharu kawada anri mita censoreduniformschoolgirlARMaroma planningaromaARM-746ARM746arm00746
    • 2019-03-07
    200 min

    [SW-618]That Old Man Is Looking At Our Panties! Let's Show Him More!! The Schoolgirls At The Family Restaurant Were So Absorbed In Their Conversation, Their Panties Were Showing. They Seemed Annoyed By My Gaze But They Started Showing Me Their Pa

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-618SW6181sw00618
    • 2019-02-22
    240 min

    [OKAX-477]A Must-See For Panty Shot Enthusiasts! A Massage Parlor Where The Girls Unintentionally Provoke You With Panty Shots. 4 Hours

  • censoreduniformschoolgirlOKAXk m producedick mandokuokazuOKAX-477OKAX47784okax00477
    • 2019-01-27
    139 min

    [FNEO-007]The Vulnerable Schoolgirl With Her Skirt Riding Up, Sitting Nonchalantly In The Passenger's Seat Of A Car In A Parking Lot Was Just Too Cute...

  • censoredcreampieschoolgirlFNEOfirst starfirst star neoFNEO-007FNEO007h-491fneo00007
    • 2018-12-06
    198 min

    [SW-599]My Little Sister And Her Friend Wanted To Become Youtubers And Earn Some Money, So They Were Filming Naughty Videos. But They Ended Up Doing Naughty Experiments With Me That Led To Us Fucking So We're Releasing It As Porn.

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-599SW5991sw00599
    • 2018-11-16
    210 min

    [DOCP-107]My Friend's JK Little Sister Was Smiling Devilishly As She Lured Me To Temptation With Panty Shot Action! She Gave Me A Furious Face Ride With Her Musty Panties And Then She Teased Me With A Horny Hot Dogging Session...

  • yui natsuhara suzu yamai censoredschoolgirlbeautiful girlDOCPprestigedoc premiumDOCP-107DOCP107118docp00107
    • 2018-11-08
    141 min

    [MIST-235]The Special Service At The Schoolgirl Observation Club 4. Yui Tomita

  • yu tomita censoredschoolgirlsingle workMISTmr michirusaitaMIST-235MIST2351mist00235
    • 2018-11-02
    135 min

    [HODV-21334]Full-Booty Panty Shot Show and the Total Domain Between Micro-Miniskirt and Knee-High Stockings The Tiniest, Cutest Classmate Kanon Momojiri

  • momojiri kanon censoredschoolgirlsingle workHODVh m pbottomsHODV-21334HODV2133441hodv021334
    • 2018-10-21
    120 min

    [KAWD-946]The Beautiful, Seductive Girl Who Tempts Me By Flashing Her Panties At Me. Ruru Arisu

  • have censoredschoolgirlslutKAWDkawaiigoemonKAWD-946KAWD946kawd00946
    • 2018-10-11
    155 min

    [SW-586]I'm Going To Roast You Like A Pig! A Glaring Delinquent Schoolgirl And Me. But She's Really Cute And She Gets All Sweet When She's Alone. She's Really A Sheep In Wolf's Clothing And She Can't Say No To Pleasure.

  • censoredschoolgirlSWswitchlight fujimaswitch switchSW-586SW5861sw00586
    • 2018-10-07
    223 min

    [HUNTA-501]This Naive Girl Said That She Was A Slut, So When I Egged Her On, I Was Able To Fuck Her! There's This Bitchy Girl In My Class Who Pretends To Be A Slut But Even A Cherry Boy Like Me Can Tell That She's Not Really A Slut She Kept O

  • censoredschoolgirlHUNTAhuntermorikihhh groupHUNTA-501HUNTA501hunta00501
    • 2018-10-07
    216 min

    [HUNTA-502]I Can't Believe I'm Living Together With My Cousin Who Ran Away From Home？ I'm Not Used To Living Together With A Girl, And Now I Can't Masturbate With Her Around So My Crotch Is About Ready To Explode! But Then... I Live A

  • censoredschoolgirlhandjobHUNTAhuntercognac kaminohhh groupHUNTA-502HUNTA502hunta00502
    • 2018-10-05
    120 min

    [TWT-025]Girls In Uniform Who Love Masturbation Are Luring You To Panty Shot Dirty Talk Temptation

  • censoredschoolgirllingerieTWTsarutoru video publishertwin tailsTWT-025TWT025h-897twt00025
    • 2018-05-04
    212 min

    [GDHH-101]I Transferred To This New School Where It Was All About "Ultra Cool Biz!" All The Students And Teachers Are Showing Off Their Bellies! Panty Shot Action Galore! An Ultra Mini Mini Uniform Action With Tits Practically Showing To Get

  • miyu saito the starry sky censoredschoolgirlGDHHgolden timekorosukehhh groupGDHH-101GDHH101gdhh00101
    • 2018-02-16
    240 min

    [GDHH-092]No Matter How Old She Gets, My Innocent Childhood Friend Likes To Play Pranks (Wrestling, Gas Pedaling My Balls, etc) On Me, And It Gets Really Rock Hard!!! Before I Knew It, She Was The Most Popular Girl In Class, And I Became A Wallflower

  • censoredschoolgirlGDHHgolden timerobby kunhhh groupGDHH-092GDHH092gdhh00092
    • 2017-12-17
    243 min

    [HUNTA-389]Do Girls Drop Their Guard Underneath The Foot Warmer？ It Was Panty Shot Heaven! One Cold Day, My Little Sister Brought Her Friends Over They All Huddled Together In The Foot Warmer Doing Their Homework, And I Decided To Take A Peek. And I

  • censoredschoolgirlsisterHUNTAhunterkawajiriHUNTA-389HUNTA389hunta00389
    • 2017-11-13
    232 min

    [HUNTA-375]When This Horny Slut Joined The Club, All The Female Members Turned Into Sluts Too! The Literary Club Is Filled With Innocent And Proper Boys And Girls And Now A Slut Has Become The Newest Member!! When She Started Seducing The Male Member

  • censoredschoolgirlHUNTAhuntermorikiHUNTA-375HUNTA375hunta00375



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download