jav beautiful girl creampie tits def




FC2WAAAMIAASHKDHNDBLKMIDEDASDFSDSSAVSAMARADTTCHRVAPODRBDBBANNATRSANHODVJULHUNTB

2024-05-04
125 min

PKPD-300 Creampie Room Drinking Document Document Saffle 3 People Gachiel Newcomer Sound

  • hibiki kare censoredcreampiebeautiful girlPKPDpakopako team and pleasant friends delusion groupPKPD-300PKPD300pkpd00300
    • 2024-05-04
    121 min

    PKPL-041 Environmental Dating OK 18 Years Old E Cup Wet Mutshi Musume Musume Yuyu Eisumi

  • esumi yuyu censoredcreampiebeautiful girlPKPLpakopako team and pleasant friends delusion groupPKPL-041PKPL041pkpl00041
    • 2024-05-04
    114 min

    XVSR-756 Awahime Togenkyo Healing And The Best Body Of Pleasure, A Beautiful Girl Soap Lady

  • tsuzuki ruisa censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-756XVSR756xvsr00756
    • 2024-05-03
    242 min

    SHIC-293 12 Girls 4 Hours 4 Hours With A Neat Face And Bristle

  • amateur censoredcreampiebeautiful girlSHICadolscence.comSHIC-293SHIC293
    • 2024-05-03
    180 min

    FPRE-039 The Hottest Whip Kawa Actress Transferred To A Electric Shock!A Cute Smile Like An Angel Who Ejaculates Me Many Times To Ejaculate Me Who Is Hospitalized By Showing Off The Full Natural Hair Pussy

  • isshiki sara censoredcreampiebig titsFPREfitchharuka yukiopreciousFPRE-039FPRE039fpre00039
    • 2024-05-03
    160 min

    CAWD-661 After The Vaginal Cum Shot, The Pursuit Sandwich Marshmallow Mashmaro Boobs Paizuri Stype Square 9 Consecutive Fire Nagisa Shiraishi

  • shiraishi nagisa censoredcreampiebeautiful girlCAWDkawaiinanzaki masakiCAWD-661CAWD661cawd00661
    • 2024-04-26
    243 min

    MBM-833 Mpo.jp Presents The ☆ Non -fiction Amateur Nampa God Best Super Strict!Cool And Beautiful Skin Girl De M Acme Edition 12 People 4 Hours 2

  • censoredcreampiebig titsMBMmbmmpo selection.committeeMBM-833MBM833h-460mbm00833
    • 2024-04-26
    74 min

    PKTA-024 P Live Interview Through!Dokata OK Every Time P Girl 24 Nagisa Chan

  • censoredcreampiePKTAp katsu oitanPKTA-024PKTA024h-1749pkta00024
    • 2024-04-17
    66 min

    TENC-018 Held A Love Love College Student Couple On The Premise Of Marriage ● Sleep With Gas NTR Target ... Big Tits G Cup Female College Student ... Yaritin University Student

  • censoredcreampiebeautiful girlTENCsod createplanettenshouTENC-018TENC0181tenc00018
    • 2024-04-03
    103 min

    SQDE-002 Otori Kansai Dialect Perverted Sister.I"m Sorry For The Photographer!SEX That Panting With The Squirting For The First Time, Losing To The Comfort While Being Impatient!Haruka Mio River

  • miogawa haruka censoredcreampiebig titsSQDEs cuteSQDE-002SQDE002sqde00002
    • 2024-03-20
    137 min

    KANO-027 [Gachi Vaginal Cum Shot Limited] Icharab Daishiki Raw Musume Haruno Yasudo

  • ando haru s censoredcreampiebeautiful girlKANOmonthly girlfriendKANO-027KANO0271kano00027
    • 2024-03-20
    125 min

    FSDSS-735 Basic Tame Mouth -to -tide -to -work Training 2 Days Of Training That Is Finished As A Vaginal Cum Shot Ran Fujii

  • fujii ranna censoredcreampiebig titsFSDSSfalenohide monkfaleno starFSDSS-735FSDSS7351fsdss00735
    • 2024-03-19
    120 min

    SDAM-110 [Kimezek Health Examination] Hentai Doctor Secretly Has An Aphrodisiac.

  • censoredcreampiebig titsSDAMsod createcaptain gangwonsod amateurSDAM-110SDAM1101sdam00110
    • 2024-03-19
    169 min

    MOGI-129 [First Shoot] G Cup Beautiful Busty Busty, Constricted Family Restaurant Clerk, A Beautiful Body That I Can"t Imagine From Clothes, She Likes To Have A Tip -tip -tip -tip -tip -tip SEX.Nuku With 4K Video!] Amakawa Shizuku

  • tenkawa shizuku censoredcreampiebig titsMOGIsod createmyzfreshly picked amateursMOGI-129MOGI1291mogi00129
    • 2024-03-16
    123 min

    MXGS-1327 My Cute Girlfriend Is A Mine -based Girl ◆ Hinako Mori

  • hinako mori censoredcreampieMXGSmaxingMXGS-1327MXGS1327h-068mxgs01327
    • 2024-03-15
    140 min

    MIMK-151 Original: Shinko Konoshiro [expressionless X Cool Attack] Mr. Mamiya In The Next Seat-Live-action Version-The Superb With A Cool Busty Beautiful Girl Who Is Approaching The Etch And The Finest Sex That Can Fulfill The Desire And Desire

  • censoredcreampiebig titsMIMKmoody shide monkmankitsuMIMK-151MIMK151mimk00151
    • 2024-03-15
    120 min

    MIAB-147 Sleepy Kime Skre X Pu I Liked It First ... I Learned That My Childhood Friend Who Was Thinking Had Dating A Best Friend, And I Slept Her And Cum Inside 15 Shots Over Kashiwagi Kashiwagi

  • kashiwagi konatsu censoredcreampiebig titsMIABmoody sdragon nishikawaeveryone s kikatanMIAB-147MIAB147miab00147
    • 2024-03-15
    120 min

    KAM-181 A Long -established Ryokan Owner Of The Northern Kanto Area Shooting Video Sleeping Music Aiming For Beautiful Girls ● Mankusa Video CASE03 Rei Misumi

  • misumi rei censoredcreampiebeautiful girlKAMkarmagroupKAM-181KAM181kam00181
    • 2024-02-24
    84 min

    CSPL-021 [4K] 4K Revolution Cheer Is Cute, But It Doesn"t Stop.Rabbit Wakui

  • wakui misato censoredcreampiebig titsCSPLcrystal picturecosdeluxe plusCSPL-021CSPL021cspl00021
    • 2024-02-23
    44 min

    AIDV-002 The World"s First AI Actress Ai Kihana Is Lifted!Initial Creampie Sexual Intercourse

  • kibana ai censoredcreampiebig titsAIDVh m pcrestfantasyAIDV-002AIDV0025642aidv00002
    • 2024-02-22
    147 min

    KANO-022 Icharab Staying Suito Room Sakura Mayu

  • horikita miki sakura mahi censoredcreampiebig titsKANOmonthly girlfriendKANO-022KANO0221kano00022
    • 2024-02-22
    145 min

    KANO-024 Creampie Room Drink Icharab Natural G Cup Musaka Yui Arisaka

  • arisaka yui censoredcreampiebeautiful girlKANOmonthly girlfriendKANO-024KANO0241kano00024
    • 2024-02-20
    99 min

    GHAT-148 Uniform, Personal Shooting, Angelic Pussy Girl, Ticklish A-cup Bust That Is Still Developing, Video Of Petite Nakanon Having Sex, Of Course, Creampied

  • censoredcreampieschoolgirlGHATnextgohatto nextGHAT-148GHAT148h-1664ghat00148
    • 2024-02-19
    69 min

    NHDTB-89201 [Noa 20 Years Old] The Weak Point Of The Unfriendly Dating Girl Who Refuses To Be Raw Is The Clitoris. When She Cums By Rubbing The Tip, He Removes The Rubber Band Without Permission And Inserts It Raw! Creampie Piston As It Is! !

  • censoredcreampiebig titsNHDTBnatural highraftin maeshironatufileNHDTB-89201NHDTB892011nhdtb89201
    • 2024-02-19
    61 min

    NHDTB-89202 [Sakura, 19 Years Old] The Weak Point Of The Unfriendly Dating Girl Who Refuses To Be Raw Is The Clitoris. When She Cums By Rubbing The Tip, She Removes The Rubber Band Without Permission And Inserts It Raw! Creampie Piston As It Is! !

  • censoredcreampiebig titsNHDTBnatural highraftin maeshironatufileNHDTB-89202NHDTB892021nhdtb89202
    • 2024-02-17
    97 min

    SUJI-221 Obscene Creampie To Daughter"s Friend Shaved Student Hinano Iori Hinano

  • iori hinano s censoredcreampiebeautiful girlSUJIrogue mousouzokuadultererSUJI-221SUJI221suji00221
    • 2024-02-17
    122 min

    SUJI-222 A Beautiful Girl With Small Breasts, Yui, Is Abducted By Her Father-in-law And Brother On The Way Home.

  • censoredcreampieSUJIrogue mousouzokuadultererSUJI-222SUJI222suji00222
    • 2024-02-17
    58 min

    CRNX-101 [4K] I Was Made To Cum So Much That I Wanted To Cry By My Master Who Only Felt Disgust... Konatsu Kashiwagi

  • kashiwagi konatsu censoredcreampiebig titsCRNXcrystal picturecrystal nextCRNX-101CRNX101crnx00101
    • 2024-02-17
    57 min

    INSTV-540 [Nagoya Beauty] Future Shachihoko Announcer! Mei, 25 Years Old, The Onikawa Castle Girl I Picked Up At Nagoya Castle Is Super Beautiful! Hotel Brought Home Video Creampie SEX

  • censoredcreampiebig titsINSTVhmn worksinstaINSTV-540INSTV540h-1472instv00540
    • 2024-02-16
    100 min

    MUDR-250 Water Honey Girl 1 & 2 A Boring Middle-aged Teacher With Creepy Glasses Sleep-rapes A Beautiful Girl With Big Breasts In A Uniform. Konatsu Kashiwagi

  • kashiwagi konatsu censoredcreampiebig titsMUDRinnocentMUDR-250MUDR250mudr00250
    • 2024-02-16
    127 min

    MXGS-1323 Marshmallow H Cup Busty Beauty Gets Addicted To The Sensual Slippery Climax Oil Massage Anna Hanayagi

  • hanayanagi anna censoredcreampiebig titsMXGSmaxingMXGS-1323MXGS1323h-068mxgs01323
    • 2024-02-16
    210 min

    PPPE-190 Returning To Okinawa From Tokyo With Sanshin! Hcup Big Breasted Islander Makes A Triumphant Return On The 3rd Anniversary Of Her AV Debut! Karen Yuzuriha

  • karen kaede censoredcreampiebig titsPPPEoppaiPPPE-190PPPE190pppe00190
    • 2024-02-16
    240 min

    MIDV-627 If You Resist Ejaculation Once An Hour With Ibukin"s Smiling God Service Technique, You Will Be Creampied Raw! A Heart-pounding Overnight Hot Spring Trip Where You Can Go Home Immediately If Something Goes Wrong In Amateur Fan Thanksgivi

  • aoi ibuki censoredcreampiebig titsMIDVmoody szampamoodyz divaMIDV-627MIDV627midv00627
    • 2024-02-15
    113 min

    HMRK-001 [Golden Ratio Erotic Body Healing Beauty] Although She Is Neat, She Likes Perverted Play! The Smile, The Blowjob Face, And The Orgasm Face Are All Cool! A Naughty And Beautiful College Girl With Beautiful Breasts And A Lovey-dovey Sex Video

  • miyanishi hikaru censoredcreampiebig titsHMRKdochameroku channelHMRK-001HMRK001h-1711hmrk00001
    • 2024-02-15
    83 min

    KAMEF-069 Specializing In Individual Photography Big Breasted Idol Photo Session Ai-chan (19) Machida Lens"s BLACK KAMEKO FILE.69 An Idol Who Knows Nothing Participates In An Obscene Photo Session Like A Part-time Job. Her Breasts Are Photographe

  • censoredcreampiebig titsKAMEFit s thursday everyone gatheredsuper dimension mugen kamekoKAMEF-069KAMEF069h-1350kamef00069
    • 2024-02-15
    92 min

    UINAV-002 [Bakki Baki Erotic Body] Mechashi Cosplay Slender Beautiful Breasts Muscle Training Girl Tipsy Muscle Protein Creampie On Cheat Day! ! [Chest Constriction Butt]

  • censoredcreampieUINAVhmn workshamedori.network secondeditionUINAV-002UINAV002h-1472uinav00002
    • 2024-02-02
    240 min

    NKM-005 Beautiful Body That You Want To Insert Every Day 4 Super Lewd Beauty SPECIAL 10 People 4 Hours

  • censoredcreampiebig titsNKMthis is it laymanNKM-005NKM005h-1631nkm00005
    • 2024-01-30
    261 min

    SPRO-095 Creampie Amateur POV Hot Spring Date Female College Student/Underground Idol/Gal X 2

  • censoredcreampiebig titsSPROamateur proSPRO-095SPRO095h-1594spro00095
    • 2024-01-26
    118 min

    ORECS-108 Pick Up A Female College Student With Outstanding Model-class Style! She Is Wearing A Bunny Girl Outfit, Exposing Her Sexy Legs And Cleavage, And Swaying Her Ass As She Boldly Serves You! "I Feel It More Than Usual...//" The JD Bunn

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-108ORECS108h-1732orecs00108
    • 2024-01-26
    26 min

    NJPD-010 Mitsuki Nagisa

  • scooping censoredcreampiebeautiful girlNJPDnew japan av actress directorynew japan av actress directoryNJPD-010NJPD010h-1754njpd00010
    • 2024-01-25
    129 min

    PFT-001 Mankitsuchu Original Work By Haruto Torasuke"s Popular Doujin Comic Live-action! Nozomi Arimura

  • censoredcreampiebig titsPFTfaleno tubedazai chinpoPFT-001PFT0011pft00001
    • 2024-01-25
    140 min

    KANO-018 Amateur Sex Lovey-dovey Creampie VOL.3 Rei & Niina

  • misumi rei it s in tomikunaga censoredcreampiebeautiful girlKANOmonthly girlfriendKANO-018KANO0181kano00018
    • 2024-01-16
    71 min

    SHSK-006 Get Raw Pussy! ! A Girl"s Serious Pseudo-love Document No.003

  • censoredcreampieblowjobSHSKthat s crazy amateur fame classSHSK-006SHSK006h-1741shsk00006
    • 2024-01-12
    142 min

    ORECS-095 7P Big Orgy In Open Air Bath & 6 Beautiful Girls In Uniform Harem SEX With Full Body Licking

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-095ORECS095h-1732orecs00095
    • 2024-01-12
    93 min

    ORECS-096 Memories Of Being Attacked By Beautiful Girls At A Hot Spring Inn Rei Hinako Suzu

  • censoredcreampieschoolgirlORECSmy amateur z second impactORECS-096ORECS096h-1732orecs00096
    • 2024-01-06
    68 min

    INSTV-522 【芋巨乳ロリ従妹】Hcupナツミちゃん。夏休みに帰省したら成長してしっかりメスになってた従妹と中出しSEXしまくったハメ撮りビデオ

  • censoredcreampiebig titsINSTVhmn worksinstaINSTV-522INSTV522h-1472instv00522
    • 2024-01-03
    52 min

    INSTV-521 [Big Breasts Icup Beautiful Girl] Perfect Breasts 102cm! Female College Student Hana-chan (21) Raw Creampie Personal Video Of An Amateur Couple Who Are Particular About The Strongest Breasts

  • censoredbig titsamateurINSTVhmn worksinstaINSTV-521INSTV521h-1472instv00521
    • 2023-12-23
    63 min

    HNHU-088 Individual Shooting Pick-up #sauna Beautiful Girl #squirting #long Tongue Kiss #crunchy Nipples #raw Creampie

  • censoredcreampiesquirtingHNHUthat s rightHNHU-088HNHU088h-1658hnhu00088
    • 2023-12-18
    178 min

    BRV-006 -Urgent MISSION- (Naughty) Pick Up A Prestigious Female College Student And Cum Inside Her! -Bunkyo Ward/Chiyoda Ward Edition-

  • censoredcreampiesquirtingBRVbravoBRV-006BRV006h-1755brv00006
    • 2023-12-15
    118 min

    ORECS-085 Naive Girls With Almost Zero Experience In Sexual Harassment Are Inspired By Their Bottomless Masochistic Hearts And Blossom Into Sadistic Women! Sarina & Mahiro

  • censoredcreampieamateurORECSmy amateur z second impactxyzORECS-085ORECS085h-1732orecs00085
    • 2023-12-08
    136 min

    ORECS-083 Rina, A Female College Student Who Was Taken Home And Fucked, Aoi-sensei Who Kindly Brushed Me Down

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-083ORECS083h-1732orecs00083
    • 2023-12-08
    130 min

    ORECS-082 Successfully Secretly Filming A JD For Sex With The Guard. Get More Drunk And Have Sex With Raw Paco And Creampie. We Had Sex Until Morning...Ran & Nene

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-082ORECS082h-1732orecs00082
    • 2023-12-08
    109 min

    ORECS-084 Naive Girls With Almost Zero Experience In Sexual Harassment Are Inspired By Their Bottomless Masochistic Hearts And Blossom Into Sadistic Women! Nanami Asuka

  • censoredcreampiebig titsORECSmy amateur z second impactxyzORECS-084ORECS084h-1732orecs00084
    • 2023-11-10
    62 min

    HNHU-082 Individual Shooting Pick-up # GET Of A Beautiful Girl With A Dark Side # Yariman Sex Beast # G Cup Beautiful Breasts # Continuous Convulsions # Begging Creampie

  • censoredcreampieamateurHNHUthat s rightHNHU-082HNHU082h-1658hnhu00082
    • 2023-11-27
    60 min

    INSTV-507 [Personal Shooting] A Beautiful Girl Who Is Envied By Everyone, OL Maina (24) With G Cup Big Breasts, Enjoys Confinement Play After A Date In The Park And Is A Perverted Meat Urinal Exclusively For Masochist Creampie. Couple"s Gonzo Vid

  • censoredbig titsamateurINSTVhmn worksinstaINSTV-507INSTV507h-1472instv00507
    • 2023-11-17
    122 min

    ORECS-072 Take Home An Erotic Drunk College Girl Paco Paco Paco And College Girl Hi & Mayu

  • censoredcreampiebig titsORECSmy amateur z second impactORECS-072ORECS072h-1732orecs00072
    • 2023-11-14
    73 min

    EROFV-217 Amateur JD [Limited] Mimi-chan, 22 Years Old, A Beautiful JD Who Is Proud Of Her Big Breasts! ! Contrary To Her Classy Appearance That Gives Off A Celebrity Atmosphere, She Is A Girl With Strong Breast Appeal, And I Violently Thrust Into He

  • censoredcreampiebig titsEROFVhmn workslove girlfriendEROFV-217EROFV217h-1472erofv00217
    • 2023-10-12
    67 min

    DORI-100 Paco Shooting No.100 Nina-chan, A Beautiful Girl With Small Breasts Who Feels So Good That She Allows Creampie, Nina Fukunaga

  • it s in tomikunaga censoredcreampieschoolgirlDORIfirst starpaco shootingDORI-100DORI100h-491dori00100
    • 2023-11-13
    75 min

    NHDTB-86302 Molester Summer Festival 2023 Creampie Special Forest School Molester Fair-skinned Energetic J○

  • censoredcreampieschoolgirlNHDTBnatural highneapolitannatufileNHDTB-86302NHDTB863021nhdtb86302
    • 2023-10-25
    331 min

    SPRO-090 Daddy Life Sex Record~! Sexy Sex With The Best Beauties I Met On SNS! !

  • censoredcreampiebig titsSPROamateur proSPRO-090SPRO090h-1594spro00090



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download