exclusive jav creampie beautiful breasts javcensored




FC2PREDHODVSHKDMIAAADNNGODJULGMEMHDKAVEMANACRAVSASQTEMIDVAPODABWAUKGSDABDTTMARA

2023-02-10
129 min

300NTK-805 [Extreme Kawa Mixed Bathing Girls JD! ! The Looks And Style Of The Crocodile Neighborhood! ! ] [Bitch Huge Breasts Paisen With Love-Filled I Cup Seven-Colored Fucking Technique] [Mixed Bathing Circle Signboard Girl! ! Fair-Skinned Smooth P

  • hijdjdwsp censoredcreampiebig titsntkntk-805ntk805300ntk-805
    • 2023-02-07
    125 min

    300MIUM-890 [Lolita Face And Beautiful Big Breasts, Cheat. ] Rent A Super Cute Cafe Clerk As Her! Complete REC Of The Whole Story Of Spearing Up To Erotic Acts That Are Originally Prohibited By Persuasion! ! After Enjoying The Hakone Travel Date, Sec

  • amateur censoredcreampieamateurmiummium-890mium890300mium-890
    • 2023-01-27
    64 min

    300NTK-762 [Intentionally Yariman! ! Local No. 1 Bitch Triumphant Return SP With A Dazzling Smile] [Glamorous Ass With Beautiful Breasts! ! Blessed Physical! ! ] [Squeezing Technique Of 100 Battles From Virgin To Yaritin! ! ] Secretly Nostalgic Outdo

  • nosex censoredcreampieamateurntkntk-762ntk762300ntk-762
    • 2023-01-18
    103 min

    ARMS-001 Paiotsu Hard-Boiled 002/Geki Iki Colossal Tits/Super Constricted Big Tits/Gigantic Big Breasts

  • amateur censoredcreampiebig titsarmsarms-001arms001arms-001
    • 2023-01-13
    85 min

    300NTK-759 [No.1 Beautiful Girl In The Light Erotic Area With F Cup Beautiful Big Breasts! ! ] Service Too! ! Boobs! ! Damn It’s Perverted…! ! Hair! ! Degree! ! The Final Bastion Is An Impregnable Production NG! ! If You Can Attack With The

  • nonocabodyng censoredcreampiebig titsntkntk-759ntk759300ntk-759
    • 2023-01-08
    106 min

    MAAN-832 [Enthusiastic Proposal Strategy X Dress Disturbed Wedding Sex! ] Even Though She"s A Cool Beauty With A Good Appearance, The Contents Are A Natural Older Sister! Sneak Peek At The Tent! Beautiful Breasts And Beautiful Legs That Are Too G

  • amateur censoredcreampieamateurmaanmaan-832maan832maan-832
    • 2022-12-23
    100 min

    VEC-566 I Just Wanted To Be Beautiful For My Husband At A Married Woman Erotic Vaginal Cum Shot Salon Where Beautiful Breasts And The Inside Of The Vagina Are Surpassed By An Adhesive Massage And Is So Squid That She Is Incontinent. Kitagawa Miku

  • kitagawa misaki censoredcreampiesingle workVECvenuspe tamegami venusVEC-566VEC566vec00566
    • 2022-12-18
    231 min

    326OMNB-003 [Limited Time Sale] Gonzo Video Of A Girl With Little Social Experience Leaked! ! Numerous Shameless Posts Covered With Desire Taken By Perverted Old Men With A Lot Of Photos [MGS Video Only]

  • amateur censoredcreampieamateuromnbomnb-003omnb003326omnb-003
    • 2022-12-14
    106 min

    300NTK-806 [God Style OL Each Defeated! ! Instant Protein! ! Instant H Special Edition] [Slender Orthodox Beauty Bitch"s Full Paisen & Gal Beauty Junior OL Bitch"s Beautiful Breasts] [Both Are Discovered To Be Shaved Miracle Hairless Generati

  • olololsp censoredcreampieamateurntkntk-806ntk806300ntk-806
    • 2022-11-19
    68 min

    300NTK-758 [H Cup Beautiful Huge Breasts & Huge Butt De Nasty Married Woman] [great Ascension With A Huge Stick With A Big Stranger] [the Tide Is Also Bishabisha Small Fish Man Beautiful Woman"s Afternoon Cheating 2NN! ! ] Cheating Induced Huge B

  • hsexnn censoredcreampiebig titsntkntk-758ntk758300ntk-758
    • 2022-11-04
    170 min

    JUQ-141 Business Trip Entertainment That Continued To Be Vaginal Cum Shot By The Arrogant President Of A Business Partner. “Beauty,” A Good Woman'S Suit Exclusive To Beautiful Breasts -. Ueba Ko

  • kamiha censoredcreampiesingle workJUQmadonnahimurokkuJUQ-141JUQ141juq00141
    • 2022-11-03
    102 min

    300MAAN-821 [American-Born Cosplay Girl] Beautiful Woman Who Loves Otaku Culture! Fair-Skinned Big Breasts + Big Butts Are The Man! ？ Paipanma Hold A Dildo In Your Mouth And Provoke Your Hips! Piercing And S******g From The Back! ! Wearing Lewd Linge

  • amateur censoredcreampiebig titsmaanmaan-821maan821300maan-821
    • 2022-07-02
    66 min

    300NTK-732 [Pleasure Switch On! !! ] [Slender Bitch Gal Convulsions] [Continuous Ichacola Squeezing 3 Barrage Of Dirty Little Level Breakthrough! !! ] Tsundere Ama Echi Echi Extra Fine Beauty Big Breasts Gal! !! The Traffic Jam Of Desire Is The Highe

  • galnn censoredcreampieamateurntkntk-732ntk732300ntk-732
    • 2022-06-13
    83 min

    300MIUM-835 A Beautiful Girl With Huge Breasts! A Relaxing And Healing Trip! I Thought, "I Love Sperm! I Can’t Settle Down Unless I Drink It Every Day …" The Metamorphosis Habit And Episodes Are A Must-See! !! The Last Is A Vaginal

  • amateur censoredcreampiebig titsmiummium-835mium835300mium-835
    • 2022-06-11
    53 min

    300NTK-728 [Big Is Justice! !! Miraculous J Cup Beautiful Girl! !! ] [Good Looks! !! Girl’s Bar Clerk With Boobs Explosion! !! ] [Earn Pocket Money With Rich Fucking Service That Makes Full Use Of Huge Breasts! !! ] Erotic Explosion J Cup Beauti

  • amateur censoredcreampiebig titsntkntk-728ntk728300ntk-728
    • 2022-06-03
    55 min

    300NTK-725 [Highest Grade A5 Rank H Cup Unfussy Beautiful Girl Jd! !! ] [Pururun Service Gonzo! !! ] [Shaking Milk! !! Spilled Breasts Explosion Piston 2nn] The Theory That Neat And Clean Huge Breasts Are Erotic On The Contrary! ？？ I Don’t Usual

  • hjdsexnn censoredcreampiebig titsntkntk-725ntk725300ntk-725
    • 2022-05-27
    76 min

    300NTK-723 [Beloved H Cup Beautiful Big Breasts Men’s Esthetic Miss! !! ] [Rubberless Customer Service Style That Is Proposed In Reverse! !! ] [Nuruteka Treatment 2 Squeezing Raw Insertion Sex! !! ] No Professional Ethics! ？？ Proposal From Her M

  • amateur censoredcreampiebig titsntkntk-723ntk723300ntk-723
    • 2022-04-15
    77 min

    300NTK-710 [Adult Eros Support For Beautiful Breasts OL] [Pink Nipple Squirting Miscellaneous Fish ● This! !! ] [3 Consecutive Squeezing With Intense Ascension] I Will Not Show It In My Daily Life! !! Nasty Duality Fascinating With The Secret Echiech

  • amateur censoredcreampieamateurntkntk-710ntk710300ntk-710
    • 2022-03-13
    66 min

    300NTK-698 [Gachi Bishoujo X Momojiri Beautiful Breasts X Icharab Aphrodisiac = Gachi Ascension 2 Squeezing] [Purin Purin Nice Bottom! !! Sensitivity Is Also Max! !! ] [Emotions And Sensitivities Can Be Shaken Off! !! ] Gachi Beautiful Girl Topping A

  • amateur censoredcreampiebig titsntkntk-698ntk698300ntk-698
    • 2022-03-07
    117 min

    300MIUM-801 Big Breasts President Secretary Is Commuting With A Vibe! Go To Kisarazu For The First Time As A Member Of Society! Men Are Fascinated By The Elegant Appearance … Moreover, When You Take It Off, You Will Be Surprised At The H Cup! !!

  • amateur censoredcreampiebig titsmiummium-801mium801300mium-801
    • 2022-03-04
    66 min

    300NTK-678 [Influencer Busty JD Is Here! !! ] [Explosive Big Breasts That Even Insist On Costumes] [Oil Makes The Whole Body Obscene! !! ] Milk Morimori Active Jd Cosplay Layer! !! Boyne Big Breasts That Shine Even In Costumes! !! Eros Explodes In Nu

  • amateur censoredcreampiebig titsntkntk-678ntk678300ntk-678
    • 2022-02-05
    85 min

    300NTK-673 [W Big Breasts OL Boss’s Home Pakopako Nn Social Gathering] [F Cup X Idol Class Looks X OL] [Home Drinking Orgy Nakadashi Sp] Rude Lecture Without Rubber Gangbang In Boss’s Home! !! Idol-Class Looks Big Breasts Echona Ol Who Remo

  • folnn censoredcreampiebig titsntkntk-673ntk673300ntk-673
    • 2022-02-05
    162 min

    [CEMD-121]キャンピングカーでエッチしようよ！4 森沢かな ～テントでトイレで車の中で！森沢かながSEXしまくる小旅行！

  • kana morisawa kanako iioka censoredcreampiemature womanCEMDceleb no tomoCEMD-121CEMD121cemd00121
    • 2022-01-29
    128 min

    [PKPL-014]E Cup Pure And Pretty Girl Natsuna Sasaki And I Stay Alone For The First Time

  • natsuna sasaki censoredcreampiebeautiful girlPKPLpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPL-014PKPL014pkpl00014
    • 2022-01-29
    140 min

    [PKPD-181]Kanna, The Female Office Worker From The Advertising Firm Has A K**ler Body. She Is A Lady Recommended For Bareback Money Shots. Kanna Asumi

  • asukami kanna censoredcreampiesingle workPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-181PKPD181pkpd00181
    • 2022-01-29
    140 min

    [PKPD-180]Rina Is A Really Masochistic Wife, Whose Husband Directly Delivers And Loans Her To Me To Do As I Tell Her And To Get A Creampie. Rina Takiguchi.

  • takiguchi rina censoredcreampiesingle workPKPDpakopakodan to yukaina nakamatachipakopako dan to yukaina nakama tachi mousozokuPKPD-180PKPD180pkpd00180
    • 2022-01-14
    82 min

    300NTK-684 [Active Gachi Underground Idol X Beautiful Breasts + Nasty = Dream Infinity Infinity] [Lustful Photo Session For Echikos! !! ] [Gachi Beautiful Breasts Porori Barrage 3 Squeezing Sex Shooting Recording! !! ] The Body That All Boys Want Is

  • amateur censoredcreampieamateurntkntk-684ntk684300ntk-684
    • 2022-01-08
    75 min

    300NTK-683 [Beautiful Big Breasts! !! A Rocket Milk Beauty Has Just Attacked! !! ] [Big Breasts! !! Big Butt! !! Explosive Sexual Desire Explodes! !! ] [New Year’s New Year Nuruteka Tits Festival 2nn] Big Breasts Encounter The Sexual Desire Of A

  • amateur censoredcreampiebig titsntkntk-683ntk683300ntk-683
    • 2022-01-08
    92 min

    300MAAN-733 [Obedient De M Pet Beautiful Girl] [Herbivorous Boyfriend Possession] [There Is A Complex In The Etch] [Ubu Butt Prep] [I Feel Hit] [Hidden De M Propensity Bare] [Squirting Iki Rolled Sex !! !! ] -I Brought Geki Ubu-Chan. ＃ 05 ～ (Ayami Em

  • amateur censoredcreampiesquirtingmaanmaan-733maan733300maan-733
    • 2022-01-07
    151 min

    [MDTE-020]My S********l Idol Lets Only Me Give Her A Creampie At Any Time. Nanami Yokomiya

  • yokomiya nanami censoredcreampieschoolgirlMDTEuchu kikakutetMDTE-020MDTE020mdte00020
    • 2022-01-01
    71 min

    300NTK-680 [Echi Echi Beautiful Breasts Tiger Akeome Sex] [Beauty Layer Princess Beginning Creampie 2nn] [Echiechi Early In The New Year] The Goddess Of Absolute Eros Appears From New Year’s Day! !! Echiechi Exquisite Body To Dress In A Tiger Co

  • olnn censoredcreampieamateurntkntk-680ntk680300ntk-680
    • 2021-12-24
    119 min

    [ROE-034]MONROE Exclusive. Educated Elite Wife Round 2!! Had Creampie Sex With Wife of Boss Who I Had A Crush On For 10 Years Before We Parted. Suzuka Kisaki

  • kisaki suzuka censoredcreampiemature womanROEmadonnaunicorn fukudamonroeROE-034ROE034roe00034
    • 2021-12-24
    118 min

    [JUL-808]The Second Exclusive For Blonde Beauty Madonna! After Having Sex With My Husband, My Father-in-law Always Makes Me Cum Inside Him... Lily Hart

  • lily heart censoredcreampiemature womanJULmadonnajotaro tomiJUL-808JUL808jul00808
    • 2021-12-17
    87 min

    [VEC-509]My Secret With Friend"s Mother. The Fact I Creampied Her. Asaka Tomita

  • asaka tomita censoredcreampiemature womanVECvenuskaniemegami venusVEC-509VEC509vec00509
    • 2021-12-11
    121 min

    [MDS-898]Papa, Mama, And I Are Being Made To Feel Good By An Old Man Every Day In A Faraway Place. Yuzu Shirakawa

  • yuzu shirakawa censoredcreampiebeautiful girlMDSuchu kikakujohnny shibuyaMDS-898MDS898mds00898
    • 2021-12-11
    150 min

    [CEMD-099]Let"s Fuck In A Camper! Part 2 Aoi Kururugi. Lewd Couple"s Over Frantic Car SEX!

  • aoi kururugi censoredcreampiemature womanCEMDserebu no tomoCEMD-099CEMD099cemd00099
    • 2021-12-03
    69 min

    300NTK-667 [Do Hentai G Breasts Beauty] [Nuruteka Sex Best] [Bring Pin Low Ona Road] It’s Out! !! Genuine De Nasty Beauty Echona! !! Normally, A Nursery Teacher’s Beautiful G-Breasted Metamorphosis Beauty Puts A Pin Low In Her Famous Instru

  • amateur censoredcreampiebig titsntkntk-667ntk667300ntk-667
    • 2021-12-03
    125 min

    [VEC-507]My Mother"s Close Friend. Kyoko Machimura

  • kyoko machimura censoredcreampiemature womanVECvenuspe tamegami venusVEC-507VEC507vec00507
    • 2021-11-21
    72 min

    300NTK-663 [Gucho Wet Breasts Maid] [Limited Legal! ？？ ] [2NN Sexual Intercourse Guidance] The Sexual Desire Of The Finest Beautiful Girl Of The Small Animal System Is A Real Carnivorous System! !! The King Of Sex Beasts Is Also Surprised By The Appe

  • sexnn censoredcreampieamateurntkntk-663ntk663300ntk-663
    • 2021-11-09
    92 min

    261ARA-515 [Petite Beautiful Girl] [Gal] Ruru Arisu! Painful Love Abnormal Gal Will Appear In AV In Search Of Stimulation W "I Want You To Treat It Roughly" Do м Remark From The Root W [Intrinsic De м] [Extreme Play] Deep Throating, Creampie,

  • amateur censoredcreampieamateuraraara-515ara515261ara-515
    • 2021-11-05
    78 min

    300NTK-655 [Beautiful Big Breasts Echona JD Geki Iki] [Beautiful Girl’S Gachi Nursing Service Blow Explosion] [Jijii Ko Cowgirl Continuous Creampie] Job Hunting JD Duo Who Will Give 3P To The End Of The Dirty Little Erotic Old Man! !! Erotic Cur

  • gjdsexnn censoredcreampiebig titsntkntk-655ntk655300ntk-655
    • 2021-10-31
    69 min

    300NTK-659 [G Breasts Beauty Big Breasts GAL Echona #Beautiful Specialized Body #Exciting 2NN Individual Shooting! !! ] G Milk GAL Loved By The God Of Beauty Giant G Milk Explosive Body! !! The Highest Sex Caste Echo Echona ♪ If It Looks Good, The Ti

  • gsex censoredcreampiebig titsntkntk-659ntk659300ntk-659
    • 2021-10-16
    109 min

    390JAC-112 [Molester Desire X Beautiful Breasts E Cup X Continuous Squirting] A Frustrated Married Woman Who Is Delusional Every Day! She Gets On The Ethical-Ignoring Molester Train "Siko Siko TRAIN" That Suddenly Appears There! Gachigachi ●

  • amateur censoredcreampiemarried womanjacjac-112jac112390jac-112
    • 2021-10-16
    67 min

    300NTK-647 [Pretty Fluffy F Cup Beautiful Breasts Beautiful Girl JD’s Hidden Metamorphosis! !! Gap Is Better In A Good Way! !! ] The Best Metamorphosis Dovich! !! My Favorite Thing Is Chin ● N! !! Special Skill Is Vaginal Cum Shot! ？？ Imara! !!

  • amateur censoredcreampiesquirtingntkntk-647ntk647300ntk-647
    • 2021-10-15
    62 min

    300NTK-646 [F Cup Beautiful Breasts Echona] [Umauma Beauty Hips] [Suddenly Inserted Pregnancy] Super Special Beauty’s Hurry Straddling Raw Chin Insertion Start! !! The Reason For Being Impatient Is The Runaway Desire For Marriage …! ？？ 2 Co

  • fsexnn censoredcreampiebig titsntkntk-646ntk646300ntk-646
    • 2021-10-09
    136 min

    [CEMD-066]Creampie Sex! An Obedient Maid Rin Kira She"s Servicing You By Receiving All Of Your Specially Rich And Thick Semen With Her Pussy, And Now Her Body Is Furiously Reacting With Pleasure!

  • kira rin censoredmature womansingle workCEMDserebu no tomoCEMD-066CEMD066cemd00066
    • 2021-10-02
    81 min

    300NTK-641 [Sorry Echona Beautiful Breasts JD X Echi Echi G Breasts JD Is A Dream Competition In The Open Air! !! ] The Open-Air Bath Where Both The Propensity And The Beautiful Body Are Fully Exposed. !! Echiachi Gangbang Sp! !! Intrinsic De Nasty E

  • amateur censoredcreampiesquirtingntkntk-641ntk641300ntk-641
    • 2021-10-02
    115 min

    [XVSR-615]Can"t Keep Myself From Sensitive I Cup Colossal Tips!! Massage Parlor Always Let"s You Fuck For Real, Hana Himesaki

  • himesaki hana censoredcreampiebig titsXVSRmax ak c takedacalenXVSR-615XVSR615xvsr00615
    • 2021-10-01
    86 min

    300MAAN-702 [Legendary! Loli Face X Big Breasts X Beautiful Girl] Rabbit Girls In The Perennial Estrus Period Who Yearn For Carnivorous Are Super Naive, But Their Sexual Desire Is More Than Anyone! "Because It’s M, I Want You To Blame Me A L

  • amateur censoredcreampiebig titsmaanmaan-702maan702300maan-702
    • 2021-10-01
    115 min

    [VEC-498]Taking Hot Married Woman From My Part Time Job Home For Creampie Fuck, Kokona Asakura

  • asakura here censoredcreampiemature womanVECvenussarumegami venusVEC-498VEC498vec00498
    • 2021-10-01
    77 min

    300NTK-640 [Echi Echi G Breasts JD X Sorrow Echona Beautiful Breasts JD Is A Dream Competition In The Open Air! !! ] Soaked W Ma ○ Ko In The Open-Air Bath Acclaimed Water Level & Water Temperature Rise! !! Echiachi Gangbang Sp! !! Straight Nasty A

  • gjdpspnn censoredcreampiebig titsntkntk-640ntk640300ntk-640
    • 2021-09-17
    84 min

    [VEC-495]The Mom"s Friend Asaka Tomita

  • asaka tomita censoredcreampiemature womanVECvenuskaniemegami venusVEC-495VEC495vec00495
    • 2021-09-15
    67 min

    300MAAN-696 [Beautiful Breasts X Nice Bottom X Beautiful Girl’S Full Spec Girls Advent] Staying Date Going To Tokyo To Graduate From A Virgin! "Etch Is Important For Compatibility", So Take An Open-Air Bath Together And First Of All, For

  • amateur censoredcreampieamateurmaanmaan-696maan696300maan-696
    • 2021-09-11
    106 min

    390JAC-110 [Ossu! Black Belt Gal ♪ × Beautiful Big Breasts F Cup × Creampie Sperm Sucking Ma ● Ko] Speaking Of "Cow Killing"？ Legendary Karate Practitioner, Mas Oyama. Then, Speaking Of "Actor Killing" …？ Yeah! !! !! Black Belt G

  • amateur censoredcreampiebig titsjacjac-110jac110390jac-110
    • 2021-09-11
    72 min

    300NTK-622 G Breasts X Beautiful Girl + Gangimari Sex Extremely Delivered! !! ● The Tuber World Is Trembling! !! Big Breasts Beauty Distributor Also Breaks The Sensitivity Limit Of Convulsions & Explosions Nama Sex Video Is Born! !! White Erotic B

  • amateur censoredcreampiebig titsntkntk-622ntk622300ntk-622
    • 2021-09-11
    155 min

    [SCOP-738]"Because You"re Truly Special..." It Was Only Supposed To Be To Comfort Me, And Just For One Night, But When My Best Friend Offered To Sleep Next To Me, I Couldn"t Resist Her Female Scent, Her Warmth, And The Way She Felt To

  • censoredcreampiebeautiful girlSCOPk m producek tarouscoop kmpSCOP-738SCOP738scop00738
    • 2021-09-10
    91 min

    DCH-012 Shizu (Ichiki Mahiro)

  • amateur censoredcreampieamateurdchdch-012dch012dch-012
    • 2021-09-04
    136 min

    [YMDD-240]Going To Onsen With Beautiful Landlady"s Superb Kissing, Full-Body Lips and Penetrative Sex Yuzu Shirakawa

  • yuzu shirakawa censoredcreampieblowjobYMDDmomotarou eizou shuppanhimurokkujaku momoYMDD-240YMDD240ymdd00240
    • 2021-09-04
    159 min

    [YMDD-242]The Little Stepsister Catering Service - She Gets To Monopolize Her Big Stepbrother"s Love! An Innocent And Pure, Angelic Little Stepsister Is Playing Erotic Pranks On Me -

  • yuzu shirakawa kanon kanon censoredcreampieblowjobYMDDmomotarou eizou shuppanasakusa ga jirojaku momoYMDD-242YMDD242ymdd00242
    • 2021-09-04
    243 min

    [MMB-384]LJO One Summer Experience Of (The Last High S*********l)

  • censoredcreampieschoolgirlMMBmomotarou eizou shuppanishikiribashi hakasemomotaro bestMMB-384MMB384mmb00384



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download