creampie javcensored jav high visio housewife




FC2PREDVEMAMEYDHDKASPRDDTTNACRSSISWANZMIAAGVHMIDESDABAUKGHODVNACXSTARSWAAAABWNGOD

2011-11-20
126 min

[SDMT-572]Girl in PE Clotes Gets Fucked in the School Restroom

  • censoredSDMTsod createharada carefreeSDMT-572SDMT5721sdmt00572
    • 2012-09-14
    64 min

    [high-116]ゆづき(18)

  • amateur censoredschoolgirlamateurhighhigh-116high116high-116
    • 2012-12-14
    75 min

    [121412-209]Does Pornstar really love fucking in private life？

  • nami honda uncensoredcreampiehandjobcaribbeancom
    • 2013-06-27
    120 min

    [IPZ-140]She Does Exactly What You Say - Schoolgirl Confinement, Torture & Rape - Yukina Momota

  • yukina momota censoredschoolgirlsingle workIPZidea pockettakuandishIPZ-140IPZ140ipz00140
    • 2013-09-12
    160 min

    [MIDE-018]Using Pressure Control so We Cum at the Same Time - Saki Ninomiya

  • ninomiya saki censoredbeautiful girlsingle workMIDEmoodyzcobamoodyz divaMIDE-018MIDE018mide00018
    • 2014-02-28
    151 min

    [DV-1604]Unsatisfied Older Sister's Greedy Sex Yui Tatsumi

  • tatsumi yui censoredsingle workDValice japanhao minamiDV-1604DV160453dv01604
    • 2015-04-07
    180 min

    [LAF-47]LaForet Girl 47 LAFORET GAL 12GAL 3HOURS : Miku Ohashi, Ruka Kanae, Mao Sena, and more

  • miku ohashi ruka kanae uncensored
    • 2015-08-08
    118 min

    [EYAN-028]Working Woman's BODY - Head Of A Cheer Club In Shibuya, This Young Wife Made It To The Top Competitions In Her School Days, Real Life Cheerleader With 13 Years Of Experience, Moe Iwasa

  • moe iwasa censoredbig titssingle workEYANe bodyhao minamiwives of hanasagariEYAN-028EYAN028eyan00028
    • 2015-10-10
    118 min

    [MIDE-275]Mistress of Cum Control Anri Okita

  • anri okita censoredbig titsslutMIDEmoodyztequilia tinomoodyz divaMIDE-275MIDE275mide00275
    • 2015-10-30
    120 min

    [LAFBD-63]LaForet Girl 63 Harnessed : Misaki Tsubasa (Blu-ray)

  • misaki tsubasa uncensored
    • 2015-12-30
    127 min

    [RTP-064]When I Met My Relatives' Daughter For The First Time In A While, I Couldn't Figure If She Was Messing With Me Because She Thought I Was A Kid, Or Just Didn't Respect Me As A Man, Because She Was Parading Herself Naked Around Me!

  • blue chuncheon serase censoredcreampieRTPprestigerealdocument plusRTP-064RTP064118rtp00064
    • 2016-05-29
    152 min

    [JUFD-604]Secretly Filmed Dirty, Wet Massage -A Wife With A Big Ass Squirms In Shame As She Pisses Herself -Misato Yoshiura

  • censoredsquirtingsingle workJUFDfitchjo styleJUFD-604JUFD604jufd00604
    • 2016-06-10
    241 min

    [MKMP-092]Hall of Fame! Super Idols 4 Hrs. Akane Yoshinaga

  • yoshinaga akane censoredcreampiebig titsMKMPk m producek taromillionMKMP-092MKMP09284mkmp00092
    • 2016-07-03
    183 min

    [SNIS-687]After A Month-Long Ban On Sex And Masturbation, She's So Horny, She's About To Explode With Adrenaline! Trembling, Lustful FUCK. Moe Amatsuka

  • angel moe censoredbeautiful girlsingle workSNISs1 no 1 styletakuanSNIS-687SNIS687snis00687
    • 2016-09-03
    45 min

    [253KAKU-160]えりか

  • amateur censoredcreampieamateurkakukaku-160kaku160253kaku-160
    • 2016-11-12
    105 min

    [SHKD-720]Escapist From Hell Rin Sakuragi

  • sakuragi ri censoredmarried womanSHKDattackershisashi takaharadeath night evilSHKD-720SHKD720shkd00720
    • 2017-02-26
    143 min

    [IPZ-903]Killer Hips Attack Ass On Parade Urumi Yurisaki

  • urumi yurisaki censoredsingle workIPZidea pocketmaeda no kahoriIPZ-903IPZ903ipz00903
    • 2017-03-10
    228 min

    [SCPX-189]Would You Like To Enjoy An NTR Sex Club Experience At The Home Of A Married Woman？ As You Were Having Your Cock Sucked In Living Room Of This MILF, Her Son Came Home, Saying, "Hey Mom, Can You Check My Homework For Me？" When Her Dau

  • censoredcreampieblowjobSCPXscoopSCPX-189SCPX189h-565scpx00189
    • 2017-04-09
    116 min

    [DOJU-078]"You Really Want To Fuck An Old Lady Like Me？" Video Of A Young Stud Taking A Completely Mature Cougar Back To His Place And Seducing Her Into Creampie Sex vol. 16

  • censoredcreampiemarried womanDOJUmature japanDOJU-078DOJU078doju00078
    • 2017-05-26
    134 min

    [MDTM-250]The Amazing Technique Of A Class President's Voluptuous Big Ass Service Aya Miyazaki

  • aya miyazaki censoredschoolgirlslutMDTMmedia station96uchu kikakuMDTM-250MDTM25061mdtm00250
    • 2017-10-15
    88 min

    [OPPW-001]O*NKO SE*SH This Cute Sexy Boy Is Becoming A She-Male And Getting Fucked Rui Nanase

  • nanase rui censoredsingle workOPPWopenipeni world mousouzokunirvana lotusOPPW-001OPPW001oppw00001
    • 2017-11-17
    178 min

    [PTS-407]Married Woman Lesbian Lovers Scream And Cream At The Anal Ecstasy Enema Salon! An Intestinal Cleaning Massage Parlor

  • censoredanallesbianPTSpetersPTS-407PTS407h-021pts00407
    • 2017-12-21
    60 min

    [200GANA-1599]マジ軟派、初撮。 983

  • amateur censoredamateurganagana-1599gana1599200gana-1599
    • 2018-01-12
    158 min

    [VRTM-321]"I Want To Have Your Baby... Daddy!" This Schoolgirl With A Big Ass Suddenly Visited Her Daddy But She Discovered That He Had A New Fiancee... She Didn't Want To Lose Her Daddy, So She Mounted Him Cowgirl Style! Once She Locked

  • ai mukai minori otani censoredcreampieschoolgirlVRTMv r produceken hosokawaVRTM-321VRTM321h-910vrtm00321
    • 2018-03-11
    105 min

    [OIGS-018]A Married Woman, Addicted To Bondage While My Husband Is Away... I Defile Myself As A Bondage Sex Slave Yui Hatano

  • yui hatano censoredmature womanbdsmOIGSavsusubashi suiOIGS-018OIGS018oigs00018
    • 2018-04-21
    37 min

    [230ORE-302]まな 22歳 OL

  • amateur censoredcreampiebig titsoreore-302ore302230ore-302
    • 2018-06-15
    111 min

    [BIJN-132]Please Watch How Sexy I Am... The Greatest Sex Of All, With Trembling Spasmic Joy, As Her Erotic Body Overflows With Semen That I'm Creampie Injecting Into Her Pleasure Palace Pussy! Sumire Mizukawa

  • mizukawa violet censoredcreampieBIJNbeautiful witch emanuelbeautiful witchBIJN-132BIJN132bijn00132
    • 2018-06-18
    100 min

    [SLAP-034]Super Mini Skirt High School Girls Blast Panty Shot 3

  • censoredschoolgirlSLAPdigital arcdigital arkSLAP-034SLAP034slap00034
    • 2018-06-30
    125 min

    [HMGL-166]Beautiful Campaign Girl Again 14 Aina and Yurika

  • censoredbig titsHMGLhmjmcompany matsuoglamorHMGL-166HMGL166h-172hmgl00166
    • 2018-07-12
    243 min

    [NHDTB-146]The Female Manager Molester - The Baseball Team, The Basketball Team, The Soccer Team -

  • censoredNHDTBnatural highitaka smithlin powderNHDTB-146NHDTB1461nhdtb00146
    • 2018-08-17
    115 min

    [TIKP-023]Woman Fed Aphrodisiacs Every Day, Slowly Transforms Into Depraved, Masochistic Sex Slave Devoid Of Reason And Knowing Only The Desire To Be Filled With Hot Cum

  • one thousand three bell censoredcreampiebeautiful girlTIKPchikikikikama delusion groupTIKP-023TIKP023tikp00023
    • 2018-08-26
    109 min

    [RHTS-048]Fucking Boss And Worker/Stepdad And Daughter, Unwanted Pregnancy/Man Next Door/Corner Store Fukc

  • hoshishima ruri aya otomo censoredmarried womandramaRHTSfa proRHTS-048RHTS048rhts00048
    • 2018-08-27
    137 min

    [HONB-072][Individual Shoot] Uniform Raw Fuck Popular Gal Multiple Fucks Threesom POV, Boyfriend Is In The Class Next Door "An-chan"

  • censoredcreampieamateurHONBmercuryfirst shibuya special attack headquartersHONB-072HONB072h-1133honb00072
    • 2018-10-14
    20 min

    [276KITAIKE-350]鈴

  • amateur censoredcreampiebig titskitaikekitaike-350kitaike350276kitaike-350
    • 2018-11-02
    263 min

    [DNW-010]Peeping On A Shibuya Slick And Slippery Oil Massage Parlor 04

  • censoredcreampiebig titsDNWprestigedocument nowDNW-010DNW010118dnw00010
    • 2018-12-12
    144 min

    [GDJU-071]Baby-Faced Lolitas With Bit Tits Baring All. Highlights. Barely Legal Girls With Big Tits Loved By Enthusiasts

  • censoredcreampiebig titsGDJUmercuryjuice mercuryGDJU-071GDJU071h-1133gdju00071
    • 2018-12-20
    246 min

    [NHDTB-215]A Married Woman With A Stroller Who Hasn't Had Sex Since Giving Birth Can't Stop Trembling And Orgasming

  • censoredsquirtingNHDTBnatural highjanken kotamaNHDTB-215NHDTB2151nhdtb00215
    • 2019-01-25
    162 min

    [DIC-054]18 Years And 8 Months Old. 09. Insatiable Lust- The Greatest 18-Year-Old Porn Actress Is Born!! Noa Tachibana

  • ai tachibana censoredsquirtingsingle workDICprestigemanhattan kimuradiscoverDIC-054DIC054118dic00054
    • 2019-02-17
    119 min

    [DDK-187]A Woman Who Loves Middle-Aged Men's Cocks Plays With Men And Breaks Them In. Haruka Akane

  • haruka censoredsluthandjobDDKdogmanormal kimDDK-187DDK187ddk00187
    • 2019-03-23
    128 min

    [CESD-735]How I Made Kana Morisawa Orgasm Over And Over Again Until She Apologized. Kana Morisawa

  • kana morisawa kanako iioka censoredmature womanCESDcelebrity friendsCESD-735CESD735cesd00735
    • 2019-04-11
    108 min

    [RCTD-214]Ass Out, Asshole Open Race Queens

  • satomi suzuki yuma tsukigase censoredanalRCTDrocketroute yamazakiRCTD-214RCTD2141rctd00214
    • 2019-04-21
    115 min

    [TEEK-003]Molester Pictorial - The Shameful Rape Of A Girl In Glasses - A Big Tits Plain Jane Girl In Glasses Who Descended Into The Pleasures Of Molester Molestation Hina Azumi

  • azumihina nagai mihina censoredTEEKavs collector stequilatinoavscollector sTEEK-003TEEK003teek00003
    • 2019-06-01
    119 min

    [JUY-865]Madonna Exclusive Hot Mature Woman!! Married Woman's Lust Fuck Dripping With Immorality!! Husband Doesn't Know -My Dirty Lust And Secret- Maki Hojo

  • hojo asahi censoredmature womansingle workJUYmadonnajyoji kawaiJUY-865JUY865juy00865
    • 2019-06-01
    329 min

    [HUNTA-608]Before I Knew It, My Room Had Become A Hangout For All The Sluts! I'm A Weak-Willed Loser, And All The Cool Kids Were Using My Place As Their Hangout, But When These Handsome Assholes Brought The Cutest Girl In Class Over, Or A Girl Wi

  • censoredschoolgirlHUNTAhuntervolvo nakanohhh groupHUNTA-608HUNTA608hunta00608
    • 2019-06-27

    [694_honoka_02]私が初めてオナニーを知った日／Honoka

  • honoka censoredamateurhonokahonoka-02honoka02694-honoka-02
    • 2019-06-29
    59 min

    [HEYZO-2024]Mona Hayami Nympho Girl Really Loves Playing With My Nipples Vol.3

  • mona hayami uncensoredcreampieheyzo
    • 2019-07-01
    480 min

    [SIS-100]8 Hours Of Incestuous Creampie Sex Videos ~Dirty Sex With My Hot Stepsisters At Home~

  • censoredcreampieslutSISglay zsisterSIS-100SIS10012sis00100
    • 2019-07-25
    240 min

    [NHDTB-295]Whenever My Wife Is On The Phone I'm Disciplining Her Bitchy Little Sch**lgirl Daughter With Endless Creampie Sex

  • censoredcreampieschoolgirlNHDTBnatural highsakurai vanillaNHDTB-295NHDTB2951nhdtb00295
    • 2019-08-07
    80 min

    259LUXU-1156 Luxury TV 1139 [G Cup Big Breasts] Breasts with outstanding sensitivity! [Big Fucking + Thick Nipple Licking] is a must-see! Sensitive Ma ● A penis is inserted into Ko and she has an ecstatic expression and falls into pleasure!

  • amateur censoredbig titsamateurluxuluxu-1156luxu1156259luxu-1156
    • 2019-08-18
    60 min

    [230OREC-365]石原さん

  • amateur censoredcreampiebig titsorecorec-365orec365230orec-365
    • 2019-10-20
    118 min

    [OIGS-029]A Bondage-Addicted Married Woman His Punishment Is Making My Pussy Throb With Pleasure Mihina

  • mihina azumihina mihina nagai censoredbdsmsingle workOIGSavs collector susubashisuiavscollector sOIGS-029OIGS029oigs00029
    • 2019-11-01
    131 min

    [ABP-917]Creampie Fuck As Much As You Want 1 Lust Bared 4 Creampies Maria Aine

  • maria aine censoredcreampiesingle workABPprestigesamantha tabataabsolutely perfectABP-917ABP917118abp00917
    • 2019-11-14
    235 min

    [AP-715]Schoolgirl "Total Domain" Prank Body Measurement

  • censoredcreampieschoolgirlAPapachebarracudahhh groupAP-715AP715ap00715
    • 2019-11-26
    60 min

    [c0930-ki191126]加村 雅 42歳

  • amateur uncensoredc0930
    • 2019-11-28
    41 min

    330PER-185 Mai (23)

  • amateur censoredamateurperper-185per185330per-185
    • 2019-12-23
    129 min

    [HTM-011]A Mature Woman Having Serious Infidelity Sex vol. 11

  • censoredbig titsamateurHTMflowerHTM-011HTM011htm00011
    • 2019-12-26
    80 min

    200GANA-2218 Seriously Nampa, first shot. 1429 Succeeded in bringing an underground idol to the hotel! The shooting of the parts model gradually became an H atmosphere … If you notice it, you will be panting and cum continuously!

  • amateur censoredamateurganagana-2218gana2218200gana-2218
    • 2020-01-15
    124 min

    [GVH-013]Stepmom Real Shota Stories, Naoko Akase

  • naoko akase censoredbig titsmomGVHglory questhyonGVH-013GVH01313gvh00013
    • 2020-02-04
    61 min

    [020420-001]Can"t Forget The Body Of My Ex Who Became My Best Friend"s Bride

  • an takase uncensoredcreampiehandjobcaribbeancom
    • 2020-02-07
    122 min

    [UMD-721]I Got Lucky To See Some Nip Slips And Kept Watching In The Hopes Of Not Getting Caught, But Maybe She Saw Me Anyway!？ 13 - The Yoga Instructor -

  • mitani akari yano tsubasa censoredsluthandjobUMDleodragon nishikawaUMD-721UMD721125umd00721



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download