big tits dmm exclusive javcensored creampie def




FC2BLKFSDSSABWMEYDAWDNACRATIDHDKAMARAMVSDWANZCAWDNACXMILKPPPDMIAAJUFEAPODADNJUL

2024-02-17
58 min

CRNX-101 [4K] I Was Made To Cum So Much That I Wanted To Cry By My Master Who Only Felt Disgust... Konatsu Kashiwagi

  • kashiwagi konatsu censoredcreampiebig titsCRNXcrystal picturecrystal nextCRNX-101CRNX101crnx00101
    • 2024-02-17
    121 min

    KSBJ-288 Yukari Ayano, A Part-timer Who Specializes In Sex Processing And Comes Looking For Masochist Training

  • ayano yukari censoredcreampiebig titsKSBJksb planning emanuelrecobaKSBJ-288KSBJ288ksbj00288
    • 2024-02-16
    210 min

    PPPE-190 Returning To Okinawa From Tokyo With Sanshin! Hcup Big Breasted Islander Makes A Triumphant Return On The 3rd Anniversary Of Her AV Debut! Karen Yuzuriha

  • karen kaede censoredcreampiebig titsPPPEoppaiPPPE-190PPPE190pppe00190
    • 2024-02-16
    140 min

    MVSD-583 A Double Bourgeois Married Woman"s Splendid Dick Play A Man-eater Mature Woman Who Sucks Up The Young Man"s Dick Extract And A Lewd Slut Sex Covered In Pheromones Yuri Oshikawa Mary Tachibana

  • yuri sugawa tachibana mary censoredcreampiebig titsMVSDm s video groupthere is alsoMVSD-583MVSD583mvsd00583
    • 2024-02-16
    240 min

    MIDV-627 If You Resist Ejaculation Once An Hour With Ibukin"s Smiling God Service Technique, You Will Be Creampied Raw! A Heart-pounding Overnight Hot Spring Trip Where You Can Go Home Immediately If Something Goes Wrong In Amateur Fan Thanksgivi

  • aoi ibuki censoredcreampiebig titsMIDVmoody szampamoodyz divaMIDV-627MIDV627midv00627
    • 2024-02-16
    119 min

    MEYD-881 At My Son"s School Festival, The PTA President, Mr. Sayama, Gave Him An Extremely Naughty Sex Education! ! Sayama Love

  • sayama love censoredcreampiebig titsMEYDtameike gorotiger gavelMEYD-881MEYD881meyd00881
    • 2024-02-16
    120 min

    KAM-177 Sexually Harassed At Her Husband"s Boss"s Promotion Party - NTR Married Woman"s Home Party - A Beautiful Big Tits And Ass Wife Gets Drunk And Fucked In Full Throat - Mizuki Yayoi

  • mizuki yayoi censoredcreampiebig titsKAMkarmagroupKAM-177KAM177kam00177
    • 2024-02-16
    200 min

    PRED-558 Karen Yuzuriha Lives With A Beautiful Older Sister, Using An Empty Old Private House As Her Love Nest And Having Sex With Her Very Intensely.

  • karen kaede censoredcreampiebig titsPREDpremiumtrendy yamaguchielegancePRED-558PRED558pred00558
    • 2024-02-16
    95 min

    VEC-632 Bringing A Beautiful Married Woman Who Works Part-time Into The House And Having Creampie Sex Mei Itsukaichi

  • itsukaichi mei censoredcreampiebig titsVECvenuskanyegoddess venusVEC-632VEC632vec00632
    • 2024-02-16
    120 min

    MIAB-111 I Will Make My Cheeky Female Brat Niece Layer Understandable With 20 Intense Pistons From Her Unparalleled Cock! Walnut Sakura

  • walnut sakura censoredcreampiebig titsMIABmoody scaptain gangwoneveryone s kikatanMIAB-111MIAB111miab00111
    • 2024-02-16
    140 min

    MUKC-052 Estrus Cosplayer Immersed In Old Man Sensitive Mass Incontinence, Peeing, Squirting Off-paco 5SEX Miku Arima

  • arima misaki censoredcreampiebig titsMUKCinnocentsolid costMUKC-052MUKC052mukc00052
    • 2024-02-16
    150 min

    EBWH-064 Surrounded By Big-breasted Adventurers With Their Own Reasons And Problems, Enjoy Sex! ？ The Result Of Me, A Healer, Joining An All-female Party.The First Live-action Version Of The Parallel World Harem Manga! !

  • kashiwagi konatsu yuna mitake censoredcreampiebig titsEBWHe bodydazai chinpoEBWH-064EBWH064ebwh00064
    • 2024-02-16
    120 min

    KAM-178 A Wife With Plump Breasts And Ass Who Is Forced To Cum To Death By Her Sexually Harassing Father-in-law Who Hates Her After Being Seen Cheating On Her And Masturbating. Her Frustrated Body Reacts And She Can"t Hold Back And Climaxes. Nene

  • nene tanaka censoredcreampiebig titsKAMkarmagroupKAM-178KAM178kam00178
    • 2024-02-16
    140 min

    FPRE-012 I Was Stuck At Work And Got Hurt After Fighting With My Boyfriend... A Rainy Weekend With My Student Who Couldn"t Go Home And Her Instincts Led Us To Each Other"s Wet Bodies And Ejaculated Deep Inside Her Vagina Over And Over Again.

  • reina taoyua censoredcreampiebig titsFPREfitchtrendy yamaguchipreciousFPRE-012FPRE012fpre00012
    • 2024-02-16
    160 min

    MIDV-629 Lifting Of The Ban: Creampie Sex For The First Time In My Life Sara Isshiki

  • isshiki sara censoredcreampiebig titsMIDVmoody smamezawa mametaromoodyz divaMIDV-629MIDV629midv00629
    • 2024-02-16
    225 min

    DVMM-064 MM Special Edition: Big-breasted AV Actress Picks Up Amateur Men! Invitation To A Full Course Service And Reverse 4P Harem Creampie Heaven At The Blue Sky Triple Big Breasts Beauty Salon! In The Magic Mirror Yuria Yoshine, Waka Misono, Miu A

  • yoshine yuria misono waka censoredcreampiebig titsDVMMdeepsueda mushroomthe magic mirror mm mm flightsDVMM-064DVMM064dvmm00064
    • 2024-02-16
    120 min

    PRED-561 When Asked, She Gets Wet To The Core...The Days When A Big-breasted Wife Indulges In Unfaithful Creampies With A Younger Man. JULIA

  • julia censoredcreampiebig titsPREDpremiumtrendy yamaguchielegancePRED-561PRED561pred00561
    • 2024-02-16
    120 min

    PPPE-204 Spence Breast Development Clinic Mary Tachibana

  • tachibana mary censoredcreampiebig titsPPPEoppaiPPPE-204PPPE204pppe00204
    • 2024-02-16
    120 min

    PPPE-195 The Straight-laced Old Man Can"t Resist Seeing His Big-breasted Niece"s Free-spirited, Defenseless, Bra-less Nipples Flashing And Fluttery Side Breasts, Which He Took In For Discipline, So He Sucks Her Breasts And Rubs Them Violently

  • kasumi tsukino censoredcreampiebig titsPPPEoppaiPPPE-195PPPE195pppe00195
    • 2024-02-16
    100 min

    MUDR-250 Water Honey Girl 1 & 2 A Boring Middle-aged Teacher With Creepy Glasses Sleep-rapes A Beautiful Girl With Big Breasts In A Uniform. Konatsu Kashiwagi

  • kashiwagi konatsu censoredcreampiebig titsMUDRinnocentMUDR-250MUDR250mudr00250
    • 2024-02-16
    120 min

    MVSD-584 Ten Days Later, My Only Beloved Sister Was Broken To The Point Of Collapse. Mizuki Yayoi, A Hidden Lewd Sister Who Was Meant To Be My Substitute But Loved Sex So Much That She Instantly Fell For The Extremely Thick Dick Of An Unparalleled Ga

  • mizuki yayoi censoredcreampiebig titsMVSDm s video groupMVSD-584MVSD584mvsd00584
    • 2024-02-16
    110 min

    MEYD-883 A Happy Married Woman In An Outdoor Tent Sauna. Shiraki Yuko

  • shiraki yuko censoredcreampiebig titsMEYDtameike goromamezawa mametaroMEYD-883MEYD883meyd00883
    • 2024-02-16
    240 min

    MKCK-352 Creampie Intercourse 84 Times, With A Young Face And Big Breasts, Injecting A Lot Of Thick Sperm Into The Immature Body Of A Girl In Uniform

  • amatsuki azu yuria hafu censoredcreampiebig titsMKCKe bodyMKCK-352MKCK352mkck00352
    • 2024-02-16
    130 min

    MIDV-625 A Big-breasted H-cup Married Woman Has An Affair With A Male College Student For The Sake Of Her Seedless Husband. A Man And A Woman Who Have 20 Fucks With 3 Part-time Jobs A Week. Fumika Nakayama

  • nakayama fumika censoredcreampiebig titsMIDVmoody strendy yamaguchimoodyz divaMIDV-625MIDV625midv00625
    • 2024-02-16
    165 min

    DVMM-069 General Male And Female Monitoring AV Big Breasted Female College Student! Could You Please Wash Your Dick In The Men"s Bath With Just A Towel？ 3 Surrounded By The Fully Erect Penises Of Male Customers, I Feel Embarrassed As I Squeeze, S

  • censoredcreampiebig titsDVMMdeepskomatsu seventeendeep sDVMM-069DVMM069dvmm00069
    • 2024-02-16
    150 min

    EBWH-072 My Brother"s Wife"s Physical Beauty Is Too Attractive... Aphrodisiac Is Mixed With Protein And A Strong Woman"s Body Is Confirmed To Be Pregnant, Creampie Sex Maria Chihaya

  • chihaya maria censoredcreampiebig titsEBWHe bodytrendy yamaguchiEBWH-072EBWH072ebwh00072
    • 2024-02-16
    120 min

    KAM-175 A Leaked Video Taken By The Owner Of A Long-established Inn In The Kanto Area. Sleeping Pills Aimed At A Beautiful Wife On A Women"s Group Comfort Trip. Creampie Rape Video 3. A Drink Was Placed In The Room Of The Inn Where She Was Stayin

  • naoko yokoyama censoredcreampiebig titsKAMkarmagroupKAM-175KAM175kam00175
    • 2024-02-16
    120 min

    PPPE-193 A Reversal Of Positions And A Compliant Pet. I Made My Cheeky Big-boobed Older Sister Who Makes Fun Of Me Understand By Humiliating Her With An Obscene Costume! Aiho Suzu

  • aiho ti censoredcreampiebig titsPPPEoppaiPPPE-193PPPE193pppe00193
    • 2024-02-07
    61 min

    HTER-005 Luxury SPA Monitor Cheating Creampie Voyeur 5 M.K

  • censoredcreampiebig titsHTERetiteroHTER-005HTER005hter00005
    • 2024-02-07
    66 min

    COSX-055 Even Though She Is A Beginner In Individual Photography, I Taught K-chan, Who Has Huge Breasts, J Cup, And A Lewd Body, The Best Part Of Individual Photography, ``seeding Photo Session.""

  • censoredcreampiebig titsCOSXuncle pacohame taking uncleCOSX-055COSX055cosx00055
    • 2024-01-26
    480 min

    CJOB-147 Reverse 3P Pincer Slut Harem BEST 52 Production Where You Can"t Move And Get Sluts

  • riho fujimori mina kitano censoredcreampiebig titsCJOBslut havenslut haven bestCJOB-147CJOB147cjob00147
    • 2024-01-24
    62 min

    COSX-050 Over 10,000 Followers! The Fair-skinned, Big-breasted Layer K-chan, Who Wears A Lewd Bunny Costume, Loves Punch Lines More Than Carrots!

  • censoredcreampiebig titsCOSXuncle pacohame taking uncleCOSX-050COSX050cosx00050
    • 2024-01-19
    120 min

    DASS-330 I Was Reunited With My Friend"s Mother, Whom I Admired For Being Beautiful, Through A Matching App. The Tension Between The Two Of Them Was Severed, And They Abandoned Their Rationality And Mingled With Each Other Based On Their Instinct

  • tachibana mary censoredcreampiebig titsDASSdassrokusaburo mishimaDASS-330DASS330dass00330
    • 2024-01-13
    125 min

    BABM-022 The J-style Mom Who Lives Next Door Pampers Me With Her Big Boobs And Tolerance! Feeling Bubbly And Baby-turning SEX Konatsu Kashiwagi

  • kashiwagi konatsu censoredcreampiebig titsBABMprincess kaguya pt delusional familynortonbab bab fruitBABM-022BABM022babm00022
    • 2024-01-13
    120 min

    BABD-010 Live Sex Once A Month On A Dangerous Day 010 Ema Chizuru Ema

  • chizuru ema censoredcreampiebig titsBABDdeep delusional familyBABD-010BABD010babd00010
    • 2024-01-13
    118 min

    JUAN-018 Naughty Big-breasted, Big-assed Niece Who Releases Double Penetration For The Pervert Parent And Child Next Door, Nio Ohara

  • osamu osamu censoredanalcreampieJUANrubyshakojiJUAN-018JUAN018juan00018
    • 2024-01-12
    150 min

    JUFE-550 An Old Man"s Gonzo Documentary - A Sweaty Sexual Intercourse That Devours Rich And Sticky Body Fluids - Suzu Aiho

  • aiho ti censoredcreampiebig titsJUFEfitchkoenji goroJUFE-550JUFE550jufe00550
    • 2024-01-12
    240 min

    PPBD-272 Pathetic Big-breasted Women Who End Up Cumming With Unwanted Pursuit Pistons! Group Circle BEST 4 Hours

  • karen kaede hitomi censoredcreampiebig titsPPBDoppaiPPBD-272PPBD272ppbd00272
    • 2024-01-12
    120 min

    PPPE-172 Spence Breast Development Clinic Yuri Honma

  • really censoredcreampiebig titsPPPEoppaiPPPE-172PPPE172pppe00172
    • 2024-01-12
    150 min

    FPRE-005 At First, She Was Reluctant To Save The Man She Loves, But... Reina Momozono, A Huge-breasted Nurse, Became So Addicted To The Sexual Harassment Directors Who Hate Her That They Felt So Good That They Writhed And Begged For Penetration.

  • reina taoyua censoredcreampiebig titsFPREfitchkitorune kawaguchipreciousFPRE-005FPRE005fpre00005
    • 2024-01-12
    129 min

    MEYD-876 I Want To Drown Even If I Lose Everything...A Double Affair With The Best Married Woman. Hatsune Minori

  • hatsune minori censoredcreampiebig titsMEYDtameike gorohiroharu osakiMEYD-876MEYD876meyd00876
    • 2024-01-12
    120 min

    KAM-172 A Beautiful Big-breasted Wife Gets Caught In The Act Of Masturbation And Cheating, And Is Driven To Death By Her Sexually Harassing Father-in-law, Who Hates Her. Hinata Kimizuka Reaches Climax Over And Over Again Thanks To Her Father-in-law&q

  • kimizuka hinata censoredcreampiebig titsKAMkarmagroupKAM-172KAM172kam00172
    • 2023-12-30
    121 min

    KSBJ-280 Shiori Tsukada, A Busty Stepmother Who Steals The Virginity Of Her Husband"s Stepchild And Asks For Creampie Over And Over Again

  • shiori tsukada censoredcreampiebig titsKSBJksb planning emanuelgentlemanKSBJ-280KSBJ280ksbj00280
    • 2023-12-30
    120 min

    KSBJ-279 Every Time I Go Back To My Husband"s Parents" House, I Am Raped And Creampied By My Father-in-law... Kuroe Kanzaki

  • kanzaki kuroe censoredcreampiebig titsKSBJksb planning emanuelcherryKSBJ-279KSBJ279ksbj00279
    • 2023-12-22
    150 min

    CJOD-410 Unlimited Ejaculation Soap For Masochistic Men That Will Make You Cum Over And Over Again With Intimate Whispers And Dirty Talk Suzu Aiho

  • aiho ti censoredcreampiebig titsCJODslut havenhiroharu osakiCJOD-410CJOD410cjod00410
    • 2023-12-15
    150 min

    JUFE-525 Memories Of A Summer At A Study Camp Where A Cute Lecturer Who Spoke The Kansai Dialect Secretly Whispered To Me That I Was A Virgin And Had Him Pulled Out Of Me Reina Momozono

  • reina taoyua censoredcreampiebig titsJUFEfitchinabarpreciousJUFE-525JUFE525jufe00525
    • 2023-12-15
    160 min

    JUFE-545 H-cup Mover Niece"s AV Debut! Plenty Of Creampie In A Masterpiece That Will Make Anyone Ejaculate Prematurely!

  • censoredcreampiebig titsJUFEfitchJUFE-545JUFE545jufe00545
    • 2023-12-15
    240 min

    PPBD-270 A Big-breasted Slut Who Loves Riding Straddles Shakes Her Breasts And Squeezes Out The Sperm, Creampie Pile Driving Cowgirl Position 55 Consecutive BEST

  • karen kaede hitomi censoredcreampiebig titsPPBDoppaiPPBD-270PPBD270ppbd00270
    • 2023-12-15
    140 min

    MIMK-143 A Story About A Quiet, Plain-looking Girl Who Turns Out To Be A Slut, And Is Sucked Out By Her Big-breasted Girlfriend.

  • censoredcreampiebig titsMIMKmoody shide monkmankitsuMIMK-143MIMK143mimk00143
    • 2023-12-15
    160 min

    MVSD-575 Ah... Ah... Akari-sensei! Please...make Me Your Teacher"s Sex Slave! After-school Training Of A Beautiful Slutty Teacher Who Seduces Her Student"s Masochist Dick Akari Neo

  • akari neo censoredcreampiebig titsMVSDm s video groupMVSD-575MVSD575mvsd00575
    • 2023-12-15
    120 min

    TPPN-244 Reason Collapses In Pleasure. Unstoppable Climax And Arousal Sweaty Creampie Sex Yuuri Oshikawa

  • yuri sugawa censoredcreampiebig titsTPPNteppanTPPN-244TPPN244tppn00244
    • 2023-12-15
    120 min

    PRED-545 Maybe I"m A Monster Of Sexual Desire, And I"m Turned On By The Plump White Skin, Beautiful Breasts, Big Ass, And Gentleness Of The Teacher I Admire...I Cum Over And Over Again With A Runaway Piston. Kana Morisawa

  • kana morisawa kanako iioka censoredcreampiebig titsPREDpremiumcaptain gangwonelegancePRED-545PRED545pred00545
    • 2023-12-15
    150 min

    MIAB-054 I Can"t Stand The Ex-slut Married Woman Who Seduces Me Without A Bra And Turns Into A Sexual Monster! Jun Suehiro Kept Having Sex Until Her Husband Came Home Even Though She Used Up All Condoms

  • suehiro ju censoredcreampiebig titsMIABmoody scameleveryone s kikatanMIAB-054MIAB054miab00054
    • 2023-12-15
    120 min

    PPPE-176 When I Missed The Last Train At A Drinking Party At Work, A Big-breasted Junior Girl Whispered Devilishly To Me, "Do You Want To Stay At My House？" Riho Matsumoto Succumbed To The Temptation Of Flashing Her Breasts In Her Loungewear

  • matsumoto riho censoredcreampiebig titsPPPEoppaiPPPE-176PPPE176pppe00176
    • 2023-11-11
    237 min

    NATR-714 Whole! Minami Mayu

  • southern eyebrow censoredcreampiebig titsNATRpinknadeshikoNATR-714NATR714natr00714
    • 2023-10-21
    130 min

    PKGP-005 Creampie Room Drinking Document Perfect Beautiful Actress With Natural G Cup Emi Nishino

  • nishino emi censoredcreampiebig titsPKGPpakopako team and pleasant friends delusion groupPKGP-005PKGP005pkgp00005
    • 2023-10-14
    180 min

    FUNK-047 A Busty Masseuse Who Can"t Hide Her Frustration Tries To Tease Me By Flashing Her Breasts, So When I Show Her My Erect Dick, She Gets Embarrassed And Resists, So I Want Her Nipples To Be Blown, So I Rub And Suck Her Big Tits, And Then I

  • censoredcreampiebig titsFUNKfuncity delusional familyfuncityFUNK-047FUNK047funk00047
    • 2023-10-13
    120 min

    PRED-525 Abstinence Acme Burst Goodbye, I"ll Go First To A World Drowning In Pleasure. With Her Tongue And Saliva Entwined, She Shakes Her Hips With All Her Might, Letting Sweat, Tide, And Juices Splatter Lewdly Until She Cums, Cums, Cums... Kare

  • karen kaede censoredcreampiebig titsPREDpremiumcomet akaielegancePRED-525PRED525pred00525
    • 2023-10-12
    78 min

    ETQR-501 Sex With A Frustrated Big-breasted Slutty Lady SHOUKO

  • censoredcreampiebig titsETQRerotic timeETQR-501ETQR501etqr00501
    • 2023-10-09
    56 min

    GML-135 Betrayal Affair 60th Anniversary Affair Wife Part 2 Shihori Mori

  • shihori mori censoredcreampiebig titsGMLglobal media entertainmentglobal media lightGML-135GML135gml00135



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download