hatano yui




FC2LULUPREDNATRSSISHODVCHRVIPXDASDSHKDATIDSQTEMIDVFSDSSHMNVENUCESDKSBJKBIAUKGCJOD

2018-11-11
233 min

[CESD-668]Hibiki Vs Yui The Revenge 3 Hibiki Otsuki Yui Hatano

  • otsuki sound yui hatano censoredmature womanslutCESDceleb no tomoenbu hiragiCESD-668CESD668cesd00668
    • 2018-11-11
    240 min

    [SVS-060]She's Luring Us To Temptation With Pantyless Pantyhose Action So We're Going To Pump This Woman Full Of Sex Until She Gives Up 10 Ladies/4 Hours

  • aki sasaki yui hatano censoredSVSavs collector savsSVS-060SVS060svs00060
    • 2018-11-10
    239 min

    [MCSR-324]With Mom 2. Me, Mom And The Obscene Spa Treatment. A Horny Married Woman Has Passionate, Incestuous Sex With Her Son In A Hot Spring Inn. 12 Women, 4 Hours

  • aki sasaki kazama yumi censoredcreampiemature womanMCSRbig morkalsaburo kamegashimamascottMCSR-324MCSR32457mcsr00324
    • 2018-11-09
    148 min

    [VRTM-390]When We Slipped This Saleslady Who Suddenly Came To Our House Some Aphrodisiacs, She Rubbed Her Black Pantyhose Legs Against My Crotch And Wrapped Her Legs Around Me In A Scissor Lock And Demanded That I Creampie Her! 5

  • kimishima mio otsuki sound censoredcreampieuniformVRTMv r produceeigo mochizukiVRTM-390VRTM390h-910vrtm00390
    • 2018-11-08
    186 min

    [RCTD-161]Bodyjack Re: Start From 0- Office Possession For Dummies

  • kimishima mio yui hatano censoredlesbiandramaRCTDrocketkiyoshi miwaRCTD-161RCTD1611rctd00161
    • 2018-10-26
    240 min

    [MDB-947]ボクだけに迫ってくる淫乱美女たち！最後の一滴まで搾りとられるALL主観BEST4時間2

  • aoi kururugi mizuno chaoyang censoredMDBmedia stationtaro kbazookaMDB-947MDB94761mdb00947
    • 2018-10-26
    243 min

    [MDB-951]BAZOOKA Presents 絶品スレンダーBODYに生中出し40発240分

  • hasumi claire yui hatano censoredcreampieMDBn abazookaMDB-951MDB95161mdb00951
    • 2018-10-26
    119 min

    [XRW-586]Japan S&M Magistrate Chapter 3 - Crazy Ropes

  • shinoda yu sakura sakihime censoredbdsmXRWreal workstomimasu diranreal real worksXRW-586XRW586172xrw00586
    • 2018-10-22
    138 min

    [CESD-659]Yui Hatano Takes The Virginity Of A Beautiful Transsexual Who Has 0 Experience With Women. 4 Ejaculations! Yui Hatano, Juri Kisaragi

  • yui hatano kisaragi juri censoredmature womanCESDceleb no tomoenbu hiragiCESD-659CESD659cesd00659
    • 2018-10-22
    113 min

    [XVSR-427]Bubble Princess Paradise, Soapland Girls That Grant Any Request! Yui Hatano

  • yui hatano censoredbeautiful girlsingle workXVSRmax ashanty yazawacalenXVSR-427XVSR427xvsr00427
    • 2018-10-21
    174 min

    [HNDS-059]Hibiki Otsuki 10th Anniversary. Real Friends Fucking, Sucking And Orgasming Wildly!! Bukkake, Creampies, Cum Swallowing Orgies. Fan Appreciation. 180-Minute Special!! Last Part

  • otsuki sound yui hatano censoredcreampiebukkakeHNDShon nakatiger kosakaiHNDS-059HNDS059hnds00059
    • 2018-10-19
    114 min

    [BIJN-142]The Body Of A Woman Who Has Completed Preparations To Receive Sperm In The Moment That She Cums, We're Going To Inject Her With Creampie Ejaculations Guaranteed To Impregnate This Bitch! Yui Hatano

  • yui hatano censoredcreampiemature womanBIJNbijin majo emmanuelleBIJN-142BIJN142bijn00142
    • 2018-10-17
    136 min

    [GVG-759]Sexy PTA Chairwoman, The Sexy Female Teacher And The Bratty Student Council Yui Hatano , Ka Ayano Fuji

  • yui hatano ayano kato censoredmature womandramaGVGglory questhyonGVG-759GVG75913gvg00759
    • 2018-10-17
    131 min

    [OVG-089]"Oh! You're Inside Me Raw!" When Her Pussy And His Dick Were Rubbing Up Against Each Other In An Oiled Up Pussy Grind Session, It Felt So Good That His Dick Just Slipped Right In, Raw!! Delivery Health Call Girls Who Got Creampie

  • shinoda yu aichi michiru censoredcreampiebig titsOVGglory questOVG-089OVG08913ovg00089
    • 2018-10-15
    122 min

    [ZEX-358]A Harlem ASMR Special!!

  • yui hatano otsuki sound censoredbig titsbeautiful girlZEXpeters maxZEX-358ZEX358h-720zex00358
    • 2018-10-13
    110 min

    [AVSA-075]My Very Own Dirty-Talking Sex Dolls. Special Version. Yui Hatano Hibiki Otsuki

  • yui hatano otsuki sound censoredAVSAavs collector savscollector sAVSA-075AVSA075avsa00075
    • 2018-10-12
    119 min

    [IPX-214]A Deep And Rich Lesbian Ban Lifting! 4 Mutually Orgasmic Lesbian Series Sex Sessions A New Sensation Orgasmic Experience Twisting Tongues Intertwining While Their Pussies Rub Up Against Each Other... Only A Woman Could Know Another Woman

  • amami tsubasa yui hatano censoredbig titslesbianIPXidea pocketzaku araidishIPX-214IPX214ipx00214
    • 2018-10-11
    142 min

    [SDMU-889]The ASMR Dirty Talk Hospital Ward 24 Hours

  • otsuki sound yui hatano censoredbig titsuniformSDMUsod createtiger kosakaiSDMU-889SDMU8891sdmu00889
    • 2018-10-11
    121 min

    [YPAA-019]My Wife Was Repeatedly Getting Fucked By Our Neighbors Yui Hatano

  • yui hatano censoredmarried womanmature womanYPAAcenter villagehazamadonntr center villageYPAA-019YPAA019h-086ypaa00019
    • 2018-09-28
    240 min

    [OKAX-426]Seeing A Hot Woman Pissing Herself Is So Filthy It's Amazing! 4 Hours

  • yuna shiina ichika kamihata censoredbig titssquirtingOKAXk m produceokazuOKAX-426OKAX42684okax00426
    • 2018-09-28
    241 min

    [HMD-026]"I Never Knew That Sex Could Feel So Good..." She's Been Neglected By Her Husband, And Now Her Erotic Body Will Easily Welcome The Cock Of Another Man

  • mizuno chaoyang shinobu igarashi censoredcreampiebig titsHMDglobal media entertainmenthypermix global media entertainmentHMD-026HMD026143hmd00026
    • 2018-09-23
    137 min

    [TCD-200]Pure Woman's Face Transsexual Losing Virginity Juri Kisaragi Yui Hatano

  • yui hatano kisaragi juri censoredTCDtrans clubenbu hiragiTCD-200TCD200tcd00200
    • 2018-09-23
    117 min

    [AVSA-074]I Made A Huge Mistake And The Business Homepage Got A Badge Saying "Raw Sex OK"... A Ton Of Horny Customers With Smelly Cum Force Me To Be Pumped Full Of Their Liquids As Their Raw Sex Call Girl Yui Hatano (Yui Hatano)

  • yui hatano censoredcreampieAVSAavs collector sran fujiokaavscollector sAVSA-074AVSA074avsa00074
    • 2018-09-22
    197 min

    [CJOD-160]Total Domain Nympho Harem Forced To Creampie Held Down By Her Beautiful Legs!!

  • otsuki sound shinoda yu censoredcreampieslutCJODslut havennanzaki masakiCJOD-160CJOD160cjod00160
    • 2018-09-20
    120 min

    [RUKO-014]I've Become Addicted To My Father-In-Law's Withered Old Dick...

  • yui hatano yukino kawai censoredmarried womanRUKOstar paradiseassRUKO-014RUKO014h-254ruko00014
    • 2018-09-16
    140 min

    [BDA-071]Female Teacher Gets Tied up and Humiliated in Her Classroom Yui Hatano

  • yui hatano censoredbukkakeBDAbermuda delusionabashiri familyBDA-071BDA071bda00071
    • 2018-09-16
    135 min

    [DDOB-036]Handjob Mommy Intense Ejaculations From Heavenly Handjobs Yui Hatano

  • yui hatano censoredsquirtingmature womanDDOBdogmatenunmy auntDDOB-036DDOB036ddob00036
    • 2018-09-16
    245 min

    [MXSPS-588]Extreme Vs. Top Class Yui Hatano And Hibiki Otsuki 4 Hours

  • yui hatano otsuki sound censoredMXSPSmaxingMXSPS-588MXSPS588h-068mxsps00588
    • 2018-09-15
    191 min

    [PTS-430]Relentless Nipple Tweaking At The Married Woman Lesbian Massage Parlor A New Style Of Sensual Development Oil Massage

  • ayano kato shinoda yu censoredmarried womanlesbianPTSpetersnanzaki masakiPTS-430PTS430h-021pts00430
    • 2018-09-09
    144 min

    [CESD-637]Fatherless Family Work Together Earning Money From Prostitution Chisato Shoda Yui Hatano Mio Kimijima

  • kimishima mio yui hatano censoredbig titsmature womanCESDserebu no tomohiiragi enbuCESD-637CESD637cesd00637
    • 2018-09-08
    200 min

    [IPX-208]Female Teacher Super Nympho Harem Forced Semen Cumming! After School Private Lesson

  • sana matsunaga yui hatano censoredbig titsslutIPXidea pocketxtissueIPX-208IPX208ipx00208
    • 2018-09-08
    159 min

    [MIAE-307]Female Teacher With A Tight Skirt's Thick Thigh Temptation Total Domain Yui Hatano

  • yui hatano censoredMIAEmoody shironori miyasemoodyz acidMIAE-307MIAE307miae00307
    • 2018-09-07
    307 min

    [DOKS-447]Handpicked. Pantyhose Mania. Footjob Special Featuring Beautiful Legs Only

  • yui hatano yuko kyoko censoredDOKSoffice k smatsumoto sex insectDOKS-447DOKS44736doks00447
    • 2018-09-05
    120 min

    [GVG-740]Ma*nko Device Bondage IV Iron Tied Up Pussy Torture Yui Hatano

  • yui hatano censoredGVGglory questGVG-740GVG74013gvg00740
    • 2018-08-31
    238 min

    [WSP-145]I Wanna Straddle... BEST

  • yui hatano yuna shiina censoredbig titssquirtingWSPwaap entertainmentwild sevenWSP-145WSP1452wsp00145
    • 2018-08-24
    241 min

    [OKAX-415]S&M Slave Raw Fuck Creampie Human Toilet 4 Hours OKAX- 415

  • yui hatano kazama yumi censoredcreampieOKAXkm produceside dishesOKAX-415OKAX41584okax00415
    • 2018-08-24
    241 min

    [TORX-008]Yui Hatano SUPER BEST COLLECTION

  • yui hatano censoredbig titssingle workTORXolgaupdatingTORX-008TORX008h-771torx00008
    • 2018-08-24
    301 min

    [BAZX-149]Proper Ladies' Tits And Ass! 30 Girls 60 Tits 30 Asses Assembly

  • kimishima mio miyu amano censoredcreampiebig titsBAZXmedia stationbazookaBAZX-149BAZX14961bazx00149
    • 2018-08-20
    240 min

    [SVS-057]S&M Bondage Woman 10 Women Gush And Cum From Being Tied Up 4 Hours

  • koyuki amano ai mizushima censoredSVSavs collector savsSVS-057SVS057svs00057
    • 2018-08-19
    145 min

    [CJOD-155]Holy Water BUKKAKE Massage Parlor Salon Yui Hatano

  • yui hatano censoredcreampiesquirtingCJODslut havennanzaki masakiCJOD-155CJOD155cjod00155
    • 2018-08-16
    69 min

    [REBDB-315]Yui3 OKINAWA Sunshine Yui Hatano

  • yui hatano censoredREBDBrebeccatakuya takahashiREBDB-315REBDB315h-346rebdb00315
    • 2018-08-16
    113 min

    [MXGS-1065]One-On-One Yoga Class For Adults Yui Hatano

  • yui hatano censoredbig titsMXGSmaxingMXGS-1065MXGS1065h-068mxgs01065
    • 2018-08-15
    481 min

    [RVG-073]Yui Hatano BEST vol. 2

  • yui hatano censoredmarried womanslutRVGglory questRVG-073RVG07313rvg00073
    • 2018-08-12
    162 min

    [CESD-618]Lesbian Lust Room Sharing - A Mature Woman And A Younger Girl In Lesbian Series Lust - Chisato Shoda Yui Hatano Mio Kimijima

  • kimishima mio yui hatano censoredlesbianmature womanCESDcelebrity friendskoike jpCESD-618CESD618cesd00618
    • 2018-08-12
    212 min

    [CESD-620]A Hibihata Battle Revenge 2 Hibiki Otsuki Yui Hatano

  • yui hatano otsuki sound censoredmature womanslutCESDserebu no tomokoike jpCESD-620CESD620cesd00620
    • 2018-08-10
    141 min

    [VRTM-375]The Female Boss Who's Always On Her High Horse Gets Drunk and Takes Raw Cock Cowgirl Style in Her Pantyhose! She Piston Fucks Her Frustration Away With Countless Orgasms! 3

  • yuki sakuragi yui hatano censoreduniformVRTMv r producetanakaVRTM-375VRTM375h-910vrtm00375
    • 2018-08-04
    117 min

    [NDRA-042]An Elite Business Man In A Cuckold Drama My Wife Became The Slutty Sex Partner To My Neighbor 6 Yui Hatano

  • yui hatano censoredbig titsmarried womanNDRAjet videoNDRA-042NDRA042ndra00042
    • 2018-08-04
    119 min

    [JUY-578]This Is The Kind Of Thing My Wife Has Been Getting Hooked On Lately Yui Hatano

  • yui hatano censoredbig titsmarried womanJUYmadonnatatsuJUY-578JUY578juy00578
    • 2018-08-01
    121 min

    [NACR-170]But... If " Yui Hatano " is ***...

  • yui hatano censoredcreampiemarried womanNACRplanet plusbirdman teppeishichidomeNACR-170NACR170h-237nacr00170
    • 2018-07-31
    29 min

    [ASKD-008]Being Creampied By My Friend's Dad Is So...

  • rika goto yui hatano censoredbig titsASKDasokoyamr kimuraasokoya originalASKD-008ASKD008h-1329askd00008
    • 2018-07-29
    199 min

    [MMNA-017]The Daily Life Of An Excessively Beautiful Lesbian Couple Sticky And Slimy Deep And Rich Kisses And Grown-Up Lesbian Sex Yui Hatano Aki Sasaki

  • aki sasaki yui hatano censoredlesbianmature womanMMNAmarrionnanzaki masakihip monsterMMNA-017MMNA017mmna00017
    • 2018-07-28
    235 min

    [TOMN-152]Furious Pre-Ejaculation Ass Shaking 60 Cum Shots 5

  • yuri shinomiya blue censoredbig titsbeautiful girlTOMNteppanteppan specialTOMN-152TOMN152tomn00152
    • 2018-07-26
    240 min

    [KUSR-044]Undercover Exhibitionist 4 Hours

  • yui hatano ayano kato censoredmarried womanslutKUSRbig mocalkowloon big mocalKUSR-044KUSR04457kusr00044
    • 2018-07-22
    159 min

    [CESD-608]The Tale Of Yui Hatano Before She Became A Porn Actress

  • yui hatano censoredbig titsmature womanCESDcelebrity friendsCESD-608CESD608cesd00608
    • 2018-07-22
    242 min

    [XVSR-404]Really Embarrassed Hot Girls Pissing! 4 Hours

  • kanae ruka yui hatano censoredbig titssquirtingXVSRmax amax ikacalenXVSR-404XVSR404xvsr00404
    • 2018-07-22
    120 min

    [XVSR-400]Naughty Creampie Life With Horny Big Sis Who's Crazy About Her Brother Yui Hatano

  • yui hatano censoredcreampieXVSRmax asono kancalenXVSR-400XVSR400xvsr00400
    • 2018-07-18
    480 min

    [RVG-070]Best Of French Kiss vol. 1

  • sasaki love sea mukai love takei maki censoredcreampiebig titsRVGglory questRVG-070RVG07013rvg00070
    • 2018-07-18
    132 min

    [GVG-715]These Married Part-Timers Are Always So Horny, They Go Straight For The New Guy's Cock! 3 Family Restaurant Edition

  • yui hatano aichi michiru censoredmarried womanGVGglory questmamezawa mametaroGVG-715GVG71513gvg00715
    • 2018-07-16
    240 min

    [MXSPS-584]Beautiful Statuesque Lust! 12 Dignified And Beautiful Female Athletes Competitive Swimsuit Edition 4 Hours vol. 4

  • akiho yoshizawa kana yui censoredMXSPSmaxingMXSPS-584MXSPS584h-068mxsps00584
    • 2018-07-16
    240 min

    [MXSPS-583]12 Alluring Queens! A Bondage-Filled (Secret) S&M Club 8

  • akiho yoshizawa kana yui censoredbdsmMXSPSmaxingMXSPS-583MXSPS583h-068mxsps00583



    • Jav Free Sex Online JAVHD, Japan xxx Free, watch porn japanese, jav uncensored download